KEGG   Desulfatibacillum alkenivorans: Dalk_2329Help
Entry
Dalk_2329         CDS       T00813                                 

Definition
(GenBank) Acetyl-CoA synthetase (Acetate-CoA ligase)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00010  Glycolysis / Gluconeogenesis
dal00620  Pyruvate metabolism
dal00640  Propanoate metabolism
dal00680  Methane metabolism
dal01100  Metabolic pathways
dal01110  Biosynthesis of secondary metabolites
dal01120  Microbial metabolism in diverse environments
dal01130  Biosynthesis of antibiotics
dal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dalk_2329
   00620 Pyruvate metabolism
    Dalk_2329
   00640 Propanoate metabolism
    Dalk_2329
  Energy metabolism
   00680 Methane metabolism
    Dalk_2329
Enzymes [BR:dal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dalk_2329
Lipid biosynthesis proteins [BR:dal01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dalk_2329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACL04022
JGI: Dalk2329
UniProt: B8FIN2
Position
3059375..3061315
Genome map
AA seq 646 aa AA seqDB search
MSNNLFTVPEDWQKRAWCDDARYQKMYDESVNDPDAFWSREAQRIDWFEPFSKVKNSSFN
GDVDIKWFLDGKLNVAYNCLDRHLEKRGDQTAIIFEGNEPGVEEKITYRQLYERVCRFSN
VLKSCGVKKGDRVSIYLPMIPQLAVAMLACARIGAIHSIVFAGFSPDALANRITDAECTI
LITADEGLRGPKAIGLKEAADEAMDKAGMVKKCIVVKHTGADVPMKAGRDLWWHELTAKE
STECPPESMDSEDPLFILYTSGSTGTPKGVLHTTGGYIVYTSLTHQYVFDYHDGDIYWCT
ADIGWVTGHSYIIYGPLANGAVTIMFEGIPNYPDFSRFWQICDKHQVNIFYTAPTVVRAL
MQQGDEPVKATSRTSVRLLGTVGEPINPEAWLWYHRVVGEERCPIVDTWWQTETGGIMIT
PLPGATALKPGSATRPFFGIQPALIDKEGNQLEGPGEGYLVMLDSWPALARTVYGDHRRF
KSTYFIQCPGTYFSGDGARRDEDGYYWITGRIDDVINVSGHRLGTAEIESSLVAHPAVSE
AAVVGFPHDIKGQAIYAYVTLSSGYEPSEELRKELSLFVRKDIGPIATPEVLQFTDSLPK
TRSGKIMRRILRKVACNELDNLGDTSTLADPAVVEALIKNRIDACR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacaaccttttcaccgtccctgaagattggcaaaaaagagcatggtgcgacgac
gcgcgttaccaaaaaatgtatgatgaatcggtcaacgatcctgatgcattctggtctcgg
gaagcgcagcgcattgactggttcgagccctttagcaaggtcaagaattccagttttaac
ggggacgtggacatcaaatggtttttggacggcaaactgaacgtggcctacaattgtttg
gacaggcacctggagaagcggggggatcagacagccattatttttgagggcaacgagccc
ggggtggaggagaaaatcacctatcgccagctttacgagagggtgtgccgcttctccaac
gtcttgaaatcctgcggggtcaaaaagggggatcgggtttccatctaccttcccatgatt
ccccagcttgcggttgccatgctggcgtgcgcccgcatcggcgccatccattccatcgtg
tttgcgggattttcgcccgacgctttggcgaaccggatcacggacgcggagtgcaccatt
ctcattaccgcggatgagggcctgcgcggccccaaggcgattggcctgaaagaagccgcc
gacgaggccatggacaaggccggcatggtcaagaaatgcattgtggtcaagcacaccggc
gcggacgttcccatgaaggcggggagggacctctggtggcatgaattgacagccaaggaa
agcacggagtgcccgcctgaaagcatggattcggaagatcccttgttcatcctgtacacg
tccgggtccacgggcacgcccaagggggtgctgcacaccacaggcggttatattgtatat
acatccctcacccaccagtacgttttcgactatcacgacggcgacatttactggtgcacg
gccgacatcggctgggtgacgggccatagctacatcatatacggccccctggccaacggg
gcggtcaccatcatgtttgaaggcatccccaattatccggatttttccaggttctggcaa
atctgcgacaagcatcaggtgaacattttctacaccgcgcctacggtggtccgggcgctc
atgcagcagggggacgagccggtgaaggcgacgtcccgcacatccgtgaggctgctgggc
acggtgggcgaacccatcaacccggaagcctggctgtggtatcacagggtggtgggcgaa
gagcgctgccccattgtggacacctggtggcagaccgagacggggggcattatgattacc
cctttacccggcgcaacagccttaaagccgggttcggccacgcggccctttttcgggatt
cagccggccctgatagataaggaaggcaaccaactggaagggccgggggaaggatacctg
gttatgctggactcgtggccggccctggcccgaaccgtatacggcgaccaccggcggttt
aagtccacctatttcatccaatgccccggaacctatttcagcggcgacggcgcccgcagg
gacgaggacgggtattactggatcaccggccgcatcgacgacgtcatcaacgtgtccggc
caccgtttgggaaccgcggagatcgaaagctccctggtggcccacccggcggtttccgaa
gcggcggtggtgggctttccgcatgacatcaagggccaggccatatacgcctacgtgacc
ctgtcctccggttatgagccgtcggaggaacttagaaaagagctttccctgttcgtccgt
aaagacatcggccccatcgccacgcctgaagtgctgcagtttaccgacagcctgcccaaa
accaggtcgggcaagatcatgcggcgcatcttgcgtaaggtggcgtgcaacgaactggac
aacctgggcgacacctccaccctggcggacccggcggtggtggaggctctgattaaaaac
aggattgacgcctgcaggtga

DBGET integrated database retrieval system