KEGG   Desulfatibacillum alkenivorans: Dalk_2389Help
Entry
Dalk_2389         CDS       T00813                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00010  Glycolysis / Gluconeogenesis
dal00030  Pentose phosphate pathway
dal00051  Fructose and mannose metabolism
dal00052  Galactose metabolism
dal00230  Purine metabolism
dal00500  Starch and sucrose metabolism
dal00520  Amino sugar and nucleotide sugar metabolism
dal00521  Streptomycin biosynthesis
dal01100  Metabolic pathways
dal01110  Biosynthesis of secondary metabolites
dal01120  Microbial metabolism in diverse environments
dal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dalk_2389
   00030 Pentose phosphate pathway
    Dalk_2389
   00051 Fructose and mannose metabolism
    Dalk_2389
   00052 Galactose metabolism
    Dalk_2389
   00500 Starch and sucrose metabolism
    Dalk_2389
   00520 Amino sugar and nucleotide sugar metabolism
    Dalk_2389
  Nucleotide metabolism
   00230 Purine metabolism
    Dalk_2389
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dalk_2389
Enzymes [BR:dal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Dalk_2389
    5.4.2.8  phosphomannomutase
     Dalk_2389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ACL04082
JGI: Dalk2389
UniProt: B8FAZ6
Position
complement(3122236..3123582)
Genome map
AA seq 448 aa AA seqDB search
MNPQMFREYDIRGIAGEDLTEENVYDLGRAIGTLLIRKGNRKIVLGRDCRVSSPSLSARA
AQGLMDAGCDLLDIGVCPTPLLSFAIHHLNAEGGVMVTASHNPPEYNGFKLSSGTDSIHG
QEIRSLLTLLDSGDFESGEGSIQDVEVKPAYQEYAANNITISKPLKVGVDAGNGTAGVIA
VPLLKALGCEVHDIYCDMDGAFPNHEPDPTVMANMQDLAALVRDKGLDLGIGFDGDGDRI
GVVDETGAMIFGDQLMTLFAREILTRKPGAVFISEVKCSQTMYDDINKRGGKAIMWKTGH
SLIRAKMKEEKAELAGEMSGHMFFADRYLGFDDAPYAACRLLEILADSGGKMSDLLSDLP
KTYNTPEIRVECPEDVKFGVVEKVTEYFRSRHEVIDIDGARIIFEDGWGLVRASNTQPVL
VLRFEALSQERLAEIREYVESVVAEIRG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgcaaatgttcagggaatacgatattcgaggaattgcaggcgaagatcttaca
gaggaaaacgtttacgatctgggcagggccattgggaccttgttaatccgcaagggaaac
cgcaaaatcgtactgggccgagattgccgcgtctcctcgccctctttgtcggcgcgcgcc
gcccaggggcttatggacgcaggctgcgatctgctggatatcggcgtgtgccccacgcct
ttgctcagcttcgccattcatcacctgaacgcggaaggcggagtcatggtcacggccagc
cacaacccgccggaatataatggtttcaagttgagcagcggtacggattccatccacggc
caggagatccgcagccttttgactttgctggatagcggggatttcgagtccggcgaagga
tccatccaagacgtggaagtcaagccggcgtatcaggaatatgcggccaacaacattacc
atatccaagcctttgaaagtgggcgtggacgcaggcaacggcacggccggcgtgatcgcc
gttcccctgctgaaagctctgggctgcgaagtgcacgatatatattgcgatatggacggc
gcctttcccaaccacgagcccgaccccacggtcatggccaacatgcaggatctggccgcc
ctggtccgggataagggcttggacctgggcatcggctttgacggagacggagaccgcatc
ggtgtggtggacgaaaccggcgccatgattttcggcgaccaattgatgacccttttcgcc
cgggaaatcctcacccgcaagcccggcgccgtattcatctccgaggtcaagtgctcccag
accatgtacgacgacatcaacaagcgcggcggcaaagccattatgtggaaaaccggccac
tccctgattcgcgccaagatgaaagaggaaaaggctgagcttgccggcgaaatgagcggg
cacatgtttttcgccgacaggtacctgggctttgacgacgccccttacgccgcctgcagg
cttttggaaatcctggccgactccggcggaaaaatgtccgaccttctttccgatttgccc
aagacctataacaccccggaaatacgtgttgaatgccccgaggacgtcaagttcggcgtg
gtggagaaagtcacggaatatttccgttcccgtcatgaggtcattgatattgacggagcg
cgtattatatttgaggacggctggggacttgtgagagcttccaacacccagccggttttg
gttttgcgcttcgaggccttgtcccaagagcgcctggctgaaatcagagagtacgtggaa
tccgtggtggctgaaatccgaggataa

DBGET integrated database retrieval system