KEGG   Desulfatibacillum alkenivorans: Dalk_2414Help
Entry
Dalk_2414         CDS       T00813                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dal00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dal00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3145134..3146207
Genome map
AA seq 357 aa AA seqDB search
MPYPYEKLTKLPAREKLTLLMRNEKLFHIIFAEQFGKKTLDLLFGVATKLRKIAKSREGQ
DFLGNLLAHKSAMLYFTQPSTRTYLSFVRACQFLGMNYAEVRDPSISSSFKGESDIDGVR
TFSNYFDLIIMRHAEGGFAERVAYLMNETGRPIPVISAGAGPDEHPTQALLDLYTLNRSF
GERAGGINGIHIAFMGDVARGRTVRSLAKLLTRYENIHMSFVSPPELKIKEDLRKWLDRR
GAKFQEIEDVNTIIKDIDAIYVTRIQDEYKDESIVEEEVNYEPYCLTMEQVNLMKPTAIV
MHPLPRRDELDVRIDQDPRAAYWKQERNGMWIRAALVAYVFNADSLINHYYTENYSH
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgccctacccctacgagaagttgaccaagctccccgcgcgcgaaaaactcacgctgctc
atgagaaacgaaaaacttttccacattatattcgccgaacaattcggcaaaaaaaccctg
gatttgttgtttggcgtggccaccaaactgcgcaagatcgcgaaatcccgtgaaggacag
gacttcttgggcaatcttctggcccacaagtcggccatgctgtatttcacccagccttcc
acaagaacctatctgtcctttgtgcgggcgtgccagtttttgggcatgaactacgccgaa
gtccgggaccccagcatttcgtcctcgttcaaaggggagagcgatattgacggcgtgcgc
accttttccaactatttcgacctgatcatcatgcgccacgccgaggggggattcgccgaa
agggtggcctatctcatgaacgaaacgggcaggcccatcccggtcatcagcgcgggcgcg
ggccctgacgagcatcccacccaggcgcttttggatctgtataccttaaaccgctccttt
ggggaaagggccggcggcatcaacggcattcacatcgcctttatgggcgacgtggcgcga
ggccgcacggtgcgctctttggccaaactcctcacccggtacgaaaacatccacatgtcc
tttgtgtctcccccggaattgaaaatcaaagaagatctaagaaaatggctggaccgcaga
ggcgccaagttccaggaaatcgaggacgtgaacaccattatcaaggatattgacgccatt
tacgtcacccgcattcaggacgagtacaaagacgaaagcattgtggaggaagaagtcaat
tacgaaccttattgcctgaccatggagcaggtgaacctgatgaagccaacggcgatcgtc
atgcaccccctgccccggcgcgacgagctggacgtgaggatcgaccaggatccccgggcc
gcttactggaagcaggagcgcaacggcatgtggattcgggccgccctggtggcttatgtt
tttaacgcggacagcctgatcaaccactattatacggaaaattacagccactaa

DBGET integrated database retrieval system