KEGG   Desulfatibacillum alkenivorans: Dalk_2424Help
Entry
Dalk_2424         CDS       T00813                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dal01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dal00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3154996..3156732
Genome map
AA seq 578 aa AA seqDB search
MDKILRINMGAEGGPKLIEDPLGDYEGLGGRAMTSAVVLKEVPADCHPLGEENKFVIAPG
MLSGTLGAQTGRISVGCKSPLTGGIKEANSGGQAAQVLARLGYAAIILEGKPADGSCYKI
VINKDGVSISEDKSLAGLGNYAVVEKVKAEYGDKVATISIGPAGEMKMGAASVAFSDMEM
RPTRHAGRGGVGAVMGAKGVKLIVLDDEGMPRRQAKDVEAFKDANKRFVAGLNSHPVTSQ
GLPAFGTNVLVNVVNEAGGFPTRNFKTGRFEGASKISGETMAEQTAARGGVVTRGCHKGC
VIRCSGDYTGPDGKWLTKQPEYETVWAHGANCGIDDLDVIAQLDRIDDDLGLDTIEMGNA
IAVAMDAGLAEFGDGEAALKLMDEVAKGTALGRIIGNGAGAVGKMFGVENVPVVKNQSLP
AYDPRAVQGIGVTYATSTQGGDHTAGYAVATNLMKVGGDVDPLKPEGNVELSRNLQIATA
SIDASGMCLFIAFAIMDQPETFQALLDMINAHYGYSWTADDWAEFGMQILRNEREFNKAA
GFTNLDDRLPKYFKKLPLAPHNITFQVTDAELDSVFNF
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaatcttacgaatcaacatgggcgccgaaggcggccccaaactcattgaagac
cctctgggagactacgaaggcctgggcggccgggccatgacctcggcggttgtgctgaag
gaagtgcctgcggactgccatcccttgggggaagaaaacaagttcgtcattgctcccggc
atgttgagcgggacattgggcgcgcagaccggccgtatttccgtggggtgcaaaagcccg
ttgaccggcggcatcaaggaggccaactccggcggccaggcggcccaagtgctggcgagg
ctgggctacgcagccatcattctggaaggcaagccggctgacggctcctgctacaagatc
gtaatcaacaaggacggcgtttccatctctgaggacaaatccctggctggattgggcaac
tatgcggttgtggagaaggtgaaggccgagtacggcgacaaggtggccaccatctccatc
ggcccggccggcgaaatgaagatgggcgccgcgtccgtggctttttccgacatggaaatg
cgccccacccgccatgcgggccgcgggggcgtgggcgccgtcatgggcgccaagggcgtc
aaattgatcgtcctggacgacgaaggcatgccccgccgtcaggccaaggacgtggaggcc
ttcaaggacgccaacaaacgctttgtggcgggcctgaactcccatcccgtcaccagccaa
ggccttccggctttcggcaccaacgttctggtgaacgtggtgaacgaggccggcggcttt
cccaccagaaacttcaagaccggccgttttgaaggcgcctccaagatcagcggcgagacc
atggccgaacaaaccgccgcccgcggcggcgtggtcacgcgcggctgccacaagggctgc
gtgatccgttgctcaggcgactacaccgggcctgacggaaaatggctcaccaagcagcct
gagtacgaaaccgtttgggcgcacggcgccaattgcggcatcgacgacctggacgtcatc
gctcagttggaccgcatcgacgacgacctgggcctggacaccattgaaatgggcaacgcc
attgctgtggccatggacgcaggcctggccgaattcggcgacggcgaagcggcgctcaag
ctcatggacgaagtggccaaaggcacggctttgggccgcattatcggcaacggcgccggc
gcagtgggcaagatgttcggcgtggaaaacgtgccggtggtcaaaaaccagtccctgccc
gcctacgaccccagggccgtccagggcatcggcgtgacctacgccaccagcacccagggc
ggagaccacaccgcgggctacgccgtggccaccaacctcatgaaggtgggcggcgacgtg
gatccgctcaagcccgaaggcaatgtggagctttcccgcaacctgcagatcgccacggcg
tccatcgacgcctcgggcatgtgcctgttcatcgccttcgccatcatggatcagccggaa
accttccaggccctgctggacatgatcaacgcccattacggctattcgtggaccgcggac
gactgggcggaattcggcatgcaaattctcaggaacgagcgggaattcaacaaggccgcc
ggcttcaccaacttggacgaccggctgcccaagtactttaaaaagctgcctctggcgccg
cacaacatcaccttccaggtgacggacgccgagttggactcggtcttcaacttctaa

DBGET integrated database retrieval system