KEGG   Desulfatibacillum alkenivorans: Dalk_2543Help
Entry
Dalk_2543         CDS       T00813                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:dal00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3308030..3309109)
Genome map
AA seq 359 aa AA seqDB search
MPGIIWNRELPLLFKHHESLQESIPWTPLVEQATPVERLDALSREAGADIWVKRDDLTSP
VYGGNKVRKLEFLLAHAQRKGSKALITMGALGTNHGLATAMFGKKAGLDVVLKLTDQPVN
EHVLQNLRLFASLGAKMDYCGGASGTVWSYYIAHRLQNAGGYYIPAGGSNSRGVLGYVEA
GLEIADQVSQGVLPRPKKVFVAAGTCGTLAGLTLGFSLAGMKTSVHGVRVTPTYMANRNK
VMGLALRSHALLKYHGAKIPEFRSNAGSLEIDSRQYGAGYGHETPQGQRAVSMAWDLEGV
KLDPTYTGKTFAAVLDEAPKAKGPVLFINTFNSVDMTDQAEAVAPDSLPKPLAQFFPAA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcctggaataatttggaacagagagcttcctctgttgttcaaacatcatgaaagcctg
caggagagcatcccttggacccccctggtggagcaggcgacgccggtggagcgtctggat
gctctcagccgggaggccggggccgatatctgggtgaaacgggacgacctcacttctccg
gtgtatggaggcaacaaggttcgcaagttggagtttttgctggcgcatgcccagaggaag
ggcagcaaggcattgattaccatgggggctttaggcaccaaccatgggctggccacggcc
atgttcggaaaaaaggcgggcctggatgtggtgttgaagttgacggatcagcccgtgaac
gagcatgttttgcaaaaccttcgcctatttgcctcgttgggcgccaagatggattactgc
ggcggggcttcaggaacggtctggtcgtattacatcgcccaccgcctgcaaaatgcggga
ggctattatattcccgccgggggctccaactcccgcggagtcctgggctatgtggaggcc
gggcttgaaatcgcggatcaggttagtcaaggggtccttcccaggcctaaaaaggttttt
gtggcggctggaacttgcggcactttggccggattgaccctgggcttttctctggccggc
atgaaaaccagcgtccacggggtgcgggtgacgcccacgtacatggccaaccgaaacaag
gtgatggggctggctttgcgttcccacgccctgctcaaatatcacggcgctaaaattcct
gaattccggtccaatgcgggaagccttgaaatcgactcccggcagtacggcgcgggatac
ggccacgaaacgcctcagggccagcgggccgtgagcatggcctgggacctggaaggcgtc
aagctggaccccacctatacgggcaagacctttgcggccgtattggacgaggcccccaag
gccaaggggccggtgctgtttatcaacaccttcaattccgtggacatgaccgatcaggcg
gaggccgtcgcccccgattccctgcccaagccgttggcgcagttttttcccgccgcctga

DBGET integrated database retrieval system