KEGG   Desulfatibacillum alkenivorans: Dalk_2708Help
Entry
Dalk_2708         CDS       T00813                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dalk_2708
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dalk_2708
   00052 Galactose metabolism
    Dalk_2708
   00500 Starch and sucrose metabolism
    Dalk_2708
   00520 Amino sugar and nucleotide sugar metabolism
    Dalk_2708
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dalk_2708
   00524 Butirosin and neomycin biosynthesis
    Dalk_2708
Enzymes [BR:dal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dalk_2708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3513165..3514388)
Genome map
AA seq 407 aa AA seqDB search
MDYYLGVDVGGTKLDFSLADETGKIVAHERFDSPFLPISEQSEDGPAQFACDVLFDDFPR
AERVRLYLEHQEAAFLQHFGSVMNGRKIAAKGVSLCGRTWERKGKIFIMGGNTPLCFAEE
SGEGKGVLMLDKKAPPPPETAPYFIENFQVEAANDGTAAATAQGVWYKAKRKIPPAKTGY
FIVGTGFGFGVPGSSAPLEIGHVPMGFIPDLLWQKCGCSASRKTACAENFASGRGIQSCA
RKLLSIKDDSQLEEMSRFFNQCNPAILGGEKVNLAELVRTSQLRGKAVNAEAVMELAGGR
ADGLCVFTANLAAYAVALCAVSAAQLLGLKVIGIGEGVAIKNPWHVENIAKMVQALAKDS
VMLPPGFKVELTPVKNISKYAALSLVAPRPFYPSWAEHMEGDAPTTF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggactattatttaggcgtggacgttggcggcaccaaactggatttttccctggccgat
gaaaccggaaaaatcgtcgctcacgaacgctttgatagtccttttctccccatatccgaa
caatcggaagacggcccggcccagttcgcctgcgatgttttatttgatgacttcccccga
gccgaaagagtcaggctatatttggaacatcaggaagccgcctttcttcagcatttcgga
tcggttatgaacgggagaaagatcgccgccaaaggcgtgagcttgtgcggcagaacatgg
gagcgtaaagggaagatttttatcatgggcggcaacacgcccttatgcttcgccgaggaa
tcgggcgaaggaaaaggggttttgatgttggataaaaaagctcccccgcctcctgagacg
gcgccgtactttattgagaattttcaagtagaggccgccaatgacggaacggccgcggcg
accgcccagggagtttggtataaggccaagcggaaaatccctccggcaaagaccggttat
tttatcgtgggaaccgggttcggcttcggcgttcccggctcctccgctcccctggaaatc
ggccatgttcccatgggctttattcccgacctgctttggcagaagtgcggatgcagcgcc
agccgcaaaacagcctgcgccgagaattttgcatcaggcagggggattcaaagctgtgcg
cggaaattgctttccatcaaagacgactcccagcttgaagaaatgagccggttttttaac
caatgcaaccccgcaatcctgggcggcgaaaaggtgaatttagccgagctggtaaggacc
tctcagctaagaggcaaggccgtcaacgcggaggccgttatggaattggcgggcggcagg
gcggacggcctgtgtgtattcacggcgaacctggcggcttatgccgtcgccctttgcgcg
gttagcgccgcccaattgttggggctgaaggtcataggcatcggcgagggcgtagccatc
aaaaatccctggcatgtggagaatatcgcgaaaatggtccaggccttggccaaagacagc
gtgatgctgccccccggtttcaaggtggagctgaccccagtaaaaaatatatccaaatac
gcggctttgtcactggttgcgccccggcctttttatccctcctgggccgagcatatggaa
ggcgacgcaccaaccactttttaa

DBGET integrated database retrieval system