KEGG   Desulfatibacillum alkenivorans: Dalk_2768Help
Entry
Dalk_2768         CDS       T00813                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dalk_2768
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dalk_2768
Enzymes [BR:dal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Dalk_2768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3573593..3575410
Genome map
AA seq 605 aa AA seqDB search
MDWNGFAGNVLYVDLSAGELESRPLSRDLCEQYLGGLGGCIRLAYENIVPGTEPLAPENP
IIVGAGTLVGTSVPASSRVYGMTRLPQSRSVGWCGGGGVNFGAFMKYAGFDFLVITGKAD
RPVYLDITGDAPVIRDAGPLWGLEVEATCDALWEKHGRPAGVLGIGQAGENQAAYAMAFV
DRLSTMGRGGFGAVMGSKNLKAVVARGMNGITVADRKAYKKLTKDLFENIRNYPYLKEWQ
DLGLMKSLPIIPREEYSEAKVRRMACVSCPIGDKDIIRVSGLTATSSSAMNLYVPTIFGM
KDHTEAVTLMTMLDGYGMDMFEFFAAVGYAGDLAAAGIISSDEATPPIDLTKFESMKIWA
EKTAFRQGLGDLIAQGLDAILERYGPEAEPYLPYKVKGMMPYAGPKAPLPWNLFGTMELG
QILDPRGPHVGSGGSPTYFAQRPLEVFPKHLKRMGVPDDALDRILPGWRDGAPTDLNIGR
LLKYSHRWFTILGSLGVCARAQINRFYNYDLCSDLYQAVTGIPTQGSDLGDRANAAWALL
KTINMREGFGRKDEEPPAKWFEEPPFCNYLTGKPITPEEVGVMTGEYYDEQGWDSETGAP
PMPAD
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggattggaacggttttgcaggtaatgtgctttacgtggatttaagcgccggcgaactg
gaatcccggcctttgtcccgagacttgtgcgaacagtatctcggcggactgggcggctgc
atccggcttgcctatgaaaatatcgttcccgggaccgagccgcttgctccggaaaacccc
attatcgttggcgccgggactttggtgggaaccagcgttccggcatcctcccgggtgtac
ggcatgaccaggctgccccaaagccgctccgtcggctggtgcgggggcgggggcgttaac
tttggcgcattcatgaaatatgcgggcttcgactttctggtgataaccggcaaggcggac
cggcccgtgtatctggacattacgggagacgctccggtcattcgcgacgccgggcctttg
tgggggctggaagtggaagcaacctgcgacgccctgtgggagaagcacggccggcccgcc
ggagtgcttggaatcggacaggccggggagaatcaggcggcctatgccatggcttttgtg
gatcgcctgtccaccatgggccggggcggcttcggcgccgtcatgggctccaagaacctg
aaagcagtggtcgccagggggatgaacggcattaccgtagcggacagaaaggcatataaa
aaactcaccaaagacctttttgaaaatatacgaaactatccctatctcaaggaatggcag
gatttagggctcatgaaatccctgcctatcattcccagggaggaatattccgaggcgaaa
gtccggcgtatggcgtgcgtatcctgccccatcggcgataaagacattatccgcgtttcc
ggcctgacggcaaccagcagttcggccatgaacctatacgtccccaccattttcggcatg
aaggatcacacagaagccgtcaccctcatgaccatgctggacggctatggcatggacatg
ttcgaatttttcgccgccgtcggctacgccggagatttggccgccgcgggaatcatatcc
tcggatgaggcgaccccgcccatagacctgacaaaatttgaatccatgaagatctgggcg
gaaaaaacggcttttcggcagggattgggagatttgatcgcccagggcctggacgcaatc
ctggagcgctatggaccggaggcggagccttatttgccgtacaaggtcaaaggcatgatg
ccctacgccggacccaaagcgcccctgccctggaaccttttcggcaccatggagttgggg
caaattttggatccgcgggggcctcatgtggggtcgggaggatcgcccacttatttcgcc
cagcgccctctggaggtttttcccaagcacctcaaacgcatgggcgtgccggacgacgcc
ctggaccgcattttgcccggatggagggatggcgcgcctacagacctgaacataggccgg
ttgctcaaatattcgcaccggtggtttaccatcctgggctcgttgggcgtatgcgccagg
gcgcaaatcaaccgcttttacaactatgatttgtgttcggacttgtaccaggcggtcaca
ggcattcccacccagggaagcgaccttggcgacagggccaacgccgcctgggccttgttg
aaaaccatcaacatgcgggaaggctttgggaggaaggatgaagagccgccggccaaatgg
tttgaagagccgcctttttgcaactacctgaccggaaagcctattacgcctgaggaagtg
ggtgtgatgaccggggagtattacgacgagcagggttgggactctgaaaccggagcgccg
cccatgcctgcagattag

DBGET integrated database retrieval system