KEGG   Desulfatibacillum alkenivorans: Dalk_2849Help
Entry
Dalk_2849         CDS       T00813                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dal00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dalk_2849
Enzymes [BR:dal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Dalk_2849
DNA repair and recombination proteins [BR:dal03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Dalk_2849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_19 AAA_30 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 AAA_22 UvrD-helicase DUF2075 UvrD_C NTPase_1 PIF1 AAA_28 AAA_5 Mg_chelatase AAA NACHT CbiA
Motif
Other DBs
NCBI-ProteinID: ACL04539
JGI: Dalk2849
UniProt: B8FB95
Position
3667306..3669075
Genome map
AA seq 589 aa AA seqDB search
MIEFEAIDGQFAAFLQKLAGGSDPVLQSAAALVSLKTREGHTCVELNSGLDQDCLLSPDC
PENPAQWIDALANSPVVGAPGEYRPLILDQAGRLYLHRYYEDQALTAKKILEWSVPDPAY
TDQDRLAQELDRLFTPLPNSETDWQKAAAATAVLRKFSVISGGPGTGKTTIAARIIRLLL
SLADGRAPSIAITAPTGKAAARLLESLGKELSRLGVPPGMEDAIPKRAKTIHRLMGARFN
SSQFIHNADNPINADILIVDEASMVELSLMARLLEALPDHGKLILLGDKDQLASVGPGSV
MGDICSGPGSQAFSPEWARVLAKAAGQAIPSENGLAPIADGIVHLVKNYRFAKDSGIGEL
ADCVVRGDAAGAAASLESGGEIIYEPVNNPRTLPALLEEPLREGFLPFITAKNPAQALEA
FGGFRVLCGVRQGPWGMNSANSLVEDIFARDGLILLRNYPWYEKRPVVVNRNDAEMNLFN
GDHGVYMDGKAAFPGLQEELRHYARSMLPAHDTAFAMTVHKSQGSEFESVLLILPGENSP
VLTRELLYTAVTRTRSRLRIVGAMPSIKKAVLSPTRRPSGLQDALWKTE
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaattcgaagccatagacggtcaattcgccgcgtttctgcagaagctggcgggc
ggctcagacccggtgctgcaatcggccgcggctctggtttcccttaaaaccagggaaggc
cacacctgcgtggagctgaattccgggctggaccaggactgcctgctcagcccggattgc
ccggaaaatccagcgcaatggattgacgccctggcgaattcgccggtggtcggagcgccc
ggggagtatcggccgctcatcctggatcaggcgggcaggctgtatttgcaccggtattat
gaagatcaggcattgaccgccaaaaaaattctggagtggagcgtcccggacccggcctat
acggaccaggaccggctggctcaggaattggatcgtttgttcacccccttgccgaatagt
gaaaccgactggcagaaggctgcggcggccacggcggttctgcgcaagttttccgtaatt
tccggcgggccggggaccggcaagaccaccatcgccgcccggatcatccgcctgcttctg
tccctggcggacgggcgggcgccctccatcgccatcacagcgcccacgggcaaggccgcg
gcaaggcttttggaatccctgggcaaagaattgagccgcctgggcgttccccctggaatg
gaggacgccattcccaaacgggccaagaccatccatcggctcatgggagcgaggttcaac
tccagtcaatttatccacaatgccgacaatcccatcaacgccgatattttgattgtagac
gaagcctccatggtggagttatccctcatggcccggcttttggaagccctgccggatcac
ggcaagctgattttgcttggggataaagaccagttggcctctgtggggccaggctcggtc
atgggcgatatttgctcaggaccggggtcgcaggctttctcaccggagtgggccagagtt
ttagccaaggccgccggacaggcgattccttcggagaatggcctggcccccatagcggac
gggatcgtgcatcttgtgaaaaactaccggttcgccaaggattcgggcatcggcgaactg
gctgattgcgtggtccggggcgacgccgcaggcgcggccgccagcctggagagcggcggg
gagatcatctacgaacccgtgaacaacccgcgcaccctgccggccctactggaagagcct
ttacgggagggctttttgccattcattacggccaaaaatccggcccaggccctggaagcc
ttcggcggattccgcgtcctgtgcggagtgcggcaaggcccctgggggatgaactcggcc
aacagcctggtggaggacatcttcgcccgggacggtctgattttgctgcggaattatccc
tggtacgaaaaaaggccggtggtggtcaatcgcaacgacgcggaaatgaatttgtttaac
ggcgaccacggagtctatatggacggcaaggcggcctttccgggcctgcaggaggagctt
cggcattacgccagatccatgctgcccgcccacgacactgcctttgccatgaccgtgcat
aaaagccaaggatcggaatttgaatccgtactgctgattctgccgggggagaactcgccg
gtgctcaccagggaattgctttatacggccgtcacccgcacccggtccaggctgcggatc
gtgggcgccatgccctccattaaaaaggcggtcctaagccccacccgccggccttccggc
ttgcaggacgcattgtggaaaacggaataa

DBGET integrated database retrieval system