KEGG   Desulfatibacillum alkenivorans: Dalk_2862Help
Entry
Dalk_2862         CDS       T00813                                 

Definition
histone deacetylase superfamily protein
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
dal  Desulfatibacillum alkenivorans
Brite
Enzymes [BR:dal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dalk_2862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3679103..3680170
Genome map
AA seq 355 aa AA seqDB search
MKKLPVWGVVGLCLFALFLCPAASGDEPEIPLPIVYSKHYNITLFGIQKLHPFDSEKYGR
VYKYLEKNVGLSPERIFEPEEISELDLLRVHSREYLDSLKKSSVVAEIAEMGALKLMPGF
LLDKKILKPMRYATGGTVLACRLALQYGWSVNLSGGYHHAKADQGEGFCFYADIPVAAHV
LWEQNPAMKIMVVDLDVHQGNGHEAVFKDDPRVFIFDMYNAEIYPRDKEAAEYIDFNLPV
AYGTEDEEYLALLKKNLEPAIIQSNPDLIIYNAGTDIYKDDPLGVLNITQDGIIDRDEQV
FRTAGKLNVPVAMVLSGGYTKESAGIIAQSMENLLENVFRAGSLRVAEASRASCI
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctgcctgtctggggcgtcgtgggcctttgcctgttcgcactatttttatgc
ccggccgcctctggcgatgagccggaaatccccttgcctattgtttacagcaagcattac
aacatcaccctgttcgggattcaaaagctccatccttttgacagcgaaaagtacggccgg
gtatacaagtatcttgagaaaaacgtcgggctgtcgcctgagcgcatctttgagccggaa
gaaatttcggagctggatcttttgcgggtgcactcccgggagtatttggactctctgaaa
aaatccagcgtggtggccgagatagccgaaatgggcgccctcaaactcatgcctggcttt
ctcctggacaagaaaatcctcaagcccatgcgatacgcgaccgggggcactgtgctggcg
tgccgcctggccctccaatacggctggagcgttaacctttcaggcggataccatcacgcc
aaggcggaccagggggagggattttgcttttacgccgacatccctgtcgccgcccatgtc
ctgtgggagcaaaacccggcaatgaagatcatggtcgtggacctggacgtccaccagggc
aacgggcatgaagcggtctttaaggacgatccgcgggttttcatctttgacatgtacaat
gcggaaatatatccccgagataaagaagcggccgaatacatcgactttaatctgcctgtc
gcctacggaacagaggatgaggagtacctcgccctgttgaagaaaaacctggagccggcc
attatccagtccaatccggacttgataatctataatgcaggcactgacatttataaagac
gacccgctgggggttttgaacattacgcaggacggaatcatagaccgggacgagcaggtc
ttcagaacggccggaaagctgaatgttcccgtcgccatggtcctttccggcggatacacc
aaggaaagcgccggcatcatcgcccaatccatggaaaacctattggaaaacgtcttcagg
gccggcagtctgagggtggcggaagcaagcagggcgtcttgcatttaa

DBGET integrated database retrieval system