KEGG   Desulfatibacillum alkenivorans: Dalk_3150Help
Entry
Dalk_3150         CDS       T00813                                 

Definition
DNA recombination protein RuvA domain I
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dal00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dalk_3150
Enzymes [BR:dal01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Dalk_3150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4004926..4005540
Genome map
AA seq 204 aa AA seqDB search
MIGYLEGKILYRQGERIMILAGGVGYEVLLPSVVSASMTKGPGDETGLYIYFHQTEKQPK
PVLIGFNSLEEREFFERFISVEAIGPIKAVSALCIPIGEIAAAIENKDSGALRKLKGIGA
RTADKIIATLRGKMAVFAGEHGGEPAGPAPVEENFHLLVLDVLVNQLGHKAAEAKELINQ
AIKRNPAISSPEELFDEVYRGETG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
ttgatcggatatcttgaaggaaaaattctgtacaggcagggggaacggatcatgatcctg
gccggcggcgtgggctacgaggtgcttttgccctcggtggtcagcgcctccatgaccaaa
ggccccggggatgaaaccgggctgtatatctacttccaccagacggaaaagcagcccaag
cccgtgctcattggcttcaactccctggaggagcgggagtttttcgaacgattcatttcc
gtggaggccatcggccccatcaaggcggtttcggccttgtgcatccccatcggagagatt
gccgcagccatcgaaaacaaggactcgggggctttgcgcaagctaaaaggcatcggcgcc
aggacggcggataaaatcatcgccacccttcggggcaaaatggccgtcttcgccggagag
cacgggggagagcctgcaggcccggcgcccgtggaggagaatttccacttgctggtgctg
gacgttctggtcaatcagttgggacataaggcggccgaggccaaggaattaatcaatcag
gccattaaacgcaaccccgccatctcctcgcccgaggagttgttcgacgaggtgtaccgg
ggggaaacagggtaa

DBGET integrated database retrieval system