KEGG   Desulfatibacillum alkenivorans: Dalk_3448Help
Entry
Dalk_3448         CDS       T00813                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dalk_3448
   01230 Biosynthesis of amino acids
    Dalk_3448
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dalk_3448
   00030 Pentose phosphate pathway
    Dalk_3448
   00051 Fructose and mannose metabolism
    Dalk_3448
   00052 Galactose metabolism
    Dalk_3448
  Energy metabolism
   00680 Methane metabolism
    Dalk_3448
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dalk_3448
Enzymes [BR:dal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dalk_3448
Protein phosphatases and associated proteins [BR:dal01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dalk_3448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4371110..4372450
Genome map
AA seq 446 aa AA seqDB search
MNPELTDTIIKTLGEAKIASPVRKSENGKPECSFQPDEDRVLVEINTEKILEQIRLGIEP
ASFEKAGPRSHIFFDPSKVRCAIVTCGGLCPGLNDIIRAIVLELTYGYGVRGIYGIRYGL
AGFIPEYRYDVVDLTPAEVEDIHGSGGTVLGSSRGPQDIGQIVDCLERMNVGILFTVGGD
GTLMASTRICDEIAKRGLKISVVGIPKTIDNDIFMVGRSFGFETAVEMATAAIRTAHTEA
VGYPNGIGLVKLMGRHSGFIAAHAALAQQDVNFVLVPEVNFDLEGENGFLKTLETRLLDR
GHAVVVAAEGAGQKFFEGENAERDASGNLKLHDIGMFLKSEIARYFDSINMEINLKFIDP
SYMIRSHPANSNDNVFCSFLARNAVHAGMAGKTRLLVGYWHDQFVHVPMDASAGKRKRID
PNGRLWMSVQEATGQRSMTNAHESCE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaatccggaattaaccgacaccataatcaaaaccctgggagaggcgaaaatcgcctcc
ccggtccgcaaatccgaaaacggaaagcccgaatgcagctttcagcctgacgaggaccgg
gtgctggtggaaatcaacaccgaaaaaatcctggagcaaatccgcctgggcatcgagccc
gcttcctttgaaaaggccggtcccagaagccatatctttttcgaccccagcaaggtccgg
tgcgccatcgtcacctgcggcggcctgtgcccgggcctgaacgacatcatccgggccatc
gtcctggagctcacctacggctacggcgtgcgcggcatttacgggataagatacggcctg
gccggattcatcccggaataccggtacgacgtggtggacctgacgcccgcggaagtggag
gacatccacggatcgggcggcacagtgctgggttcgtcccggggcccccaggacatcggc
cagattgtggattgcctggaacgcatgaacgtgggcattttgtttaccgtgggcggggac
ggcaccctcatggcctccacaaggatctgcgacgaaatcgccaaacgcggcctgaaaatc
agcgtggtgggcatccccaaaaccatcgacaacgacatctttatggtgggccgctccttc
gggtttgaaaccgccgtggaaatggccaccgccgccattcgtaccgcccataccgaggcc
gtgggataccccaacggcatcgggctagtcaagctcatgggccgccattccgggtttatc
gcggcccacgcggccctggctcagcaggacgtgaattttgtcctggttccggaagtgaat
ttcgacctggaaggggaaaacggttttctcaaaaccctggaaacccgccttttggaccgg
ggccacgccgtggtcgtggccgccgaaggcgccgggcaaaaattctttgaaggggaaaac
gcagagcgggacgcttccggcaacctgaagctccacgatatcggcatgttcttaaaaagc
gaaatcgccagatactttgactccatcaacatggagatcaacctcaaattcatcgatccc
agctacatgattcgcagccatccggccaattccaacgacaacgtgttttgcagcttcctg
gcccggaacgccgtccacgccggcatggccggcaaaacccgcctgctcgtggggtattgg
cacgaccagttcgttcacgtgcccatggacgcctcggccggcaaacgtaagcgcatcgat
cccaacggccgcctgtggatgagcgtccaggaagccaccggccagcgcagcatgaccaat
gctcatgagtcgtgcgaataa

DBGET integrated database retrieval system