KEGG   Desulfatibacillum alkenivorans: Dalk_3448Help
Entry
Dalk_3448         CDS       T00813                                 

Definition
(GenBank) Pyrophosphate-fructose 6-phosphate 1-phosphotransferase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00010  Glycolysis / Gluconeogenesis
dal00030  Pentose phosphate pathway
dal00051  Fructose and mannose metabolism
dal00052  Galactose metabolism
dal00680  Methane metabolism
dal01100  Metabolic pathways
dal01110  Biosynthesis of secondary metabolites
dal01120  Microbial metabolism in diverse environments
dal01130  Biosynthesis of antibiotics
dal01200  Carbon metabolism
dal01230  Biosynthesis of amino acids
dal03018  RNA degradation
Module
dal_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dalk_3448
   00030 Pentose phosphate pathway
    Dalk_3448
   00051 Fructose and mannose metabolism
    Dalk_3448
   00052 Galactose metabolism
    Dalk_3448
  Energy metabolism
   00680 Methane metabolism
    Dalk_3448
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dalk_3448
Enzymes [BR:dal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dalk_3448
Protein phosphatases and associated proteins [BR:dal01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dalk_3448
Messenger RNA biogenesis [BR:dal03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dalk_3448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACL05136
JGI: Dalk3448
UniProt: B8FLJ0
Position
4371110..4372450
Genome map
AA seq 446 aa AA seqDB search
MNPELTDTIIKTLGEAKIASPVRKSENGKPECSFQPDEDRVLVEINTEKILEQIRLGIEP
ASFEKAGPRSHIFFDPSKVRCAIVTCGGLCPGLNDIIRAIVLELTYGYGVRGIYGIRYGL
AGFIPEYRYDVVDLTPAEVEDIHGSGGTVLGSSRGPQDIGQIVDCLERMNVGILFTVGGD
GTLMASTRICDEIAKRGLKISVVGIPKTIDNDIFMVGRSFGFETAVEMATAAIRTAHTEA
VGYPNGIGLVKLMGRHSGFIAAHAALAQQDVNFVLVPEVNFDLEGENGFLKTLETRLLDR
GHAVVVAAEGAGQKFFEGENAERDASGNLKLHDIGMFLKSEIARYFDSINMEINLKFIDP
SYMIRSHPANSNDNVFCSFLARNAVHAGMAGKTRLLVGYWHDQFVHVPMDASAGKRKRID
PNGRLWMSVQEATGQRSMTNAHESCE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaatccggaattaaccgacaccataatcaaaaccctgggagaggcgaaaatcgcctcc
ccggtccgcaaatccgaaaacggaaagcccgaatgcagctttcagcctgacgaggaccgg
gtgctggtggaaatcaacaccgaaaaaatcctggagcaaatccgcctgggcatcgagccc
gcttcctttgaaaaggccggtcccagaagccatatctttttcgaccccagcaaggtccgg
tgcgccatcgtcacctgcggcggcctgtgcccgggcctgaacgacatcatccgggccatc
gtcctggagctcacctacggctacggcgtgcgcggcatttacgggataagatacggcctg
gccggattcatcccggaataccggtacgacgtggtggacctgacgcccgcggaagtggag
gacatccacggatcgggcggcacagtgctgggttcgtcccggggcccccaggacatcggc
cagattgtggattgcctggaacgcatgaacgtgggcattttgtttaccgtgggcggggac
ggcaccctcatggcctccacaaggatctgcgacgaaatcgccaaacgcggcctgaaaatc
agcgtggtgggcatccccaaaaccatcgacaacgacatctttatggtgggccgctccttc
gggtttgaaaccgccgtggaaatggccaccgccgccattcgtaccgcccataccgaggcc
gtgggataccccaacggcatcgggctagtcaagctcatgggccgccattccgggtttatc
gcggcccacgcggccctggctcagcaggacgtgaattttgtcctggttccggaagtgaat
ttcgacctggaaggggaaaacggttttctcaaaaccctggaaacccgccttttggaccgg
ggccacgccgtggtcgtggccgccgaaggcgccgggcaaaaattctttgaaggggaaaac
gcagagcgggacgcttccggcaacctgaagctccacgatatcggcatgttcttaaaaagc
gaaatcgccagatactttgactccatcaacatggagatcaacctcaaattcatcgatccc
agctacatgattcgcagccatccggccaattccaacgacaacgtgttttgcagcttcctg
gcccggaacgccgtccacgccggcatggccggcaaaacccgcctgctcgtggggtattgg
cacgaccagttcgttcacgtgcccatggacgcctcggccggcaaacgtaagcgcatcgat
cccaacggccgcctgtggatgagcgtccaggaagccaccggccagcgcagcatgaccaat
gctcatgagtcgtgcgaataa

DBGET integrated database retrieval system