KEGG   Desulfatibacillum alkenivorans: Dalk_3532Help
Entry
Dalk_3532         CDS       T00813                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dal00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4479619..4481661
Genome map
AA seq 680 aa AA seqDB search
MKNNVFPFSAIVGQDILRRALSLCAVNPAVGGVLVRGEKGTAKSTAVRALAKLLPRIPVY
QDCPYGCNPDMPEERCPVCQARAQEAKVRFKRRPVVTLPLNATEDRVAGGLDFDLAVKNG
VRVLQPGLLAKSHRGILYVDEVNLLDDHIVDLVLSSASTGENRVEREGLSVCHAARFMLV
GTMNPEEGELRPQFLDRFGLCVEIGSEQDVETRARIMRRREAFDLDKDAFHDRFAKAEAQ
TADSIQAASALLPRVKMKDSLRDLIANLCAEKYVAGHRAELVIEQAARAHAALGGRTEVT
EGDIEAVAPMALLHRTRDAAPPPPPPEPEEQEEEQQEPPDHDPPENEEEDQELPPEQEES
QEQEDAGPPPPPEQEEAPPEEEMQPPEQEEERESSSMDKIFEVGQNFKVKRIQAPKDRVF
RRGSGRRSRTRVAQKQGRYVKSRPRKHSDDIALDATLRNAAPFQARRKAEGDSNLAVILK
KEDLQERIREKRIGNFLLFVVDASGSMGAKGRMAASKGAIMSLLLDAYQKRDKVAMVSFR
KDEALVNLPPTSSVELAAKLLAELPIGGKTPLAAGMVKCAEMVRNALVRDPSMRPIVLFI
TDGKANVGLNGGKPVPEAMELAERLSQDERVHYVVVDTESRGLVRFGLAGRLAESLGARY
FQVEDLRAEQLVDITRNEDW
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaatgtatttcccttttccgccattgtaggccaggacatcctgcggcgcgct
ttgtctttgtgcgctgtcaatccggctgtgggcggggttttggtgcggggagaaaaaggc
acagccaaatccacggctgtcagggctttggcgaagctgctgccccgtataccggtttat
caagactgtccgtacggatgcaatcccgatatgccggaggagcgatgccccgtctgccag
gcgagagcccaggaagccaaagtgcgttttaaacgcaggcccgtggtcactttgccgttg
aacgctacggaggaccgggtggccggcggcctggattttgatttggccgttaaaaacggg
gtgcgggttctgcagcccggcctgttggccaagtcgcatcgcggcattttatacgtggac
gaagtcaacctgctggacgaccacattgtggacctggtcctttcctccgccagcacaggt
gaaaaccgggtggagcgggaaggcctttccgtttgccacgcggctcggttcatgctggtg
ggcaccatgaatcccgaggaaggagagcttcggcctcaattcttggatcgattcggcttg
tgcgtggagatcgggtctgagcaggatgtggaaacccgggcgagaatcatgcgccgcaga
gaggcttttgacctggacaaggacgccttccacgatagattcgccaaggcggaggcccag
acggccgactccatccaggcggcttcggccctgctgcccagggtgaaaatgaaagacagc
ctgcgggatttgatcgccaacttatgcgcggaaaaatacgttgcaggacacagggcggaa
ctggtcattgagcaggcggccagggcgcacgcagcccttggcggaagaacggaagttacg
gaaggcgatatagaggccgtggcgcctatggcgcttttgcatcgcacccgggacgctgcg
ccccctcccccgccgcccgagccggaagagcaggaggaggaacagcaggagccgccggat
cacgatccaccggagaacgaagaagaggatcaggagcttccgccggagcaggaggaatcc
caggaacaggaagacgcgggaccgccgcctccgcccgagcaggaggaagcgcctcctgaa
gaagaaatgcagcctcccgagcaggaggaagagcgggaatccagctcgatggacaaaatt
ttcgaggtgggccaaaactttaaggtgaaacgcatccaggcgcccaaggacagggtcttt
cgccggggctccggccggaggtcccgcacccgggtggctcaaaagcagggccggtacgtc
aaaagcaggcccagaaagcattcggatgacatcgccctggacgccacattgagaaacgcg
gcgccttttcaggccagaagaaaggcggagggcgattccaacctcgccgtcatcctgaaa
aaagaagatttgcaggagcgtatccgggaaaaacgcatcggcaactttttgttgtttgtg
gtggacgccagcggttccatgggcgccaaaggccggatggcggcgtccaagggggcgatc
atgtccctgcttttggacgcctatcaaaaacgggacaaagtggccatggtgtcgttccgc
aaggacgaggccctggttaacctgccgcccacgtcctccgtggagttggcggccaagctc
ctggcggagctgccgataggcggcaagacgcccctggccgccgggatggtgaaatgcgcc
gaaatggttcgcaacgccctggtgcgcgatccctccatgcggcccattgtcctgtttatt
actgacggcaaggccaacgtagggctgaacggcggcaagcccgtgcccgaagccatggag
ctggccgagcgtctgtcccaggatgaacgggttcattacgtggtggtggatacggaaagc
cggggcttggtccgcttcggcctggcaggcaggctggctgaaagccttggcgccaggtac
tttcaagtagaagacctccgggctgaacagctcgtggatattacaagaaacgaggattgg
taa

DBGET integrated database retrieval system