KEGG   Desulfatibacillum alkenivorans: Dalk_3533Help
Entry
Dalk_3533         CDS       T00813                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dal00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4481662..4482693
Genome map
AA seq 343 aa AA seqDB search
MKRKTVFPFAAIVGQDMMKLALILNVINPTLSGVLIRGEKGTGKSTAVRALADILPEIDV
ISDCPFELSPQDEQDAYEECMTALTGEAPKSGDLESYKRKVRVVELPVGATEDRVVGTLD
LEHALRKGTKRVEPGLLAAAHRGILYVDEVNLLDDHIVDVLLDSAAMGVNTIEREGVSFS
HPAKFTLVGTMNPEEGELRPQLLDRFGLCVHVTGVEDMESRVLIMKRRVAFDENPANFTA
QFDQESANIAQSITKAREVYPKVKVPESMYAEIAKCCLEVGVDGHRADIIMLKTAKTLAA
YDAREEVAPKDIETASQLVLPHRVRRVPLQDVVTDISAARGRK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtaagacggtatttccctttgcagcaatcgtaggtcaggacatgatgaaactg
gccttgattttgaacgtaatcaaccccaccctttccggcgtactgattcgcggggaaaaa
ggaactggaaaatccacggccgtgcgcgccctggccgatattctgccggaaatcgacgtg
atttccgactgcccttttgagctttcgccccaagacgaacaggacgcttatgaagaatgt
atgaccgccctgaccggagaagcgccgaaaagcggcgacctggaatcttacaaaagaaaa
gtccgggtggtggagcttcctgtaggcgccacggaagaccgggttgtgggcaccctggac
ctggagcacgctttgcgcaaagggaccaaaagggtggagcccggccttttggccgccgcg
caccggggaattttgtacgtggacgaagtcaaccttttggacgaccacattgtagacgtg
cttctggactccgcggccatgggcgtgaacaccatcgaacgcgagggggtcagcttttcc
cacccggccaagtttactctggtgggcaccatgaaccccgaagaaggggagcttcggccc
cagttgctggaccgctttgggctttgcgtgcatgtgaccggcgtggaagacatggaatcc
cgggtgctgatcatgaagcgccgggtcgcttttgacgaaaacccggccaatttcaccgcc
caattcgaccaggagtccgccaacatcgcccagagcataaccaaagccagggaggtgtat
cccaaggtgaaggttccggaatccatgtatgcggaaatcgccaaatgctgcctggaagtg
ggcgtggacgggcatcgggccgacatcatcatgctgaagaccgccaagaccctggccgcg
tacgacgcccgggaagaggtggcacccaaagacattgaaaccgcatctcaactggtgctg
ccccatcgcgtcaggcgggttcccctccaggacgtggttacggacatcagcgcggcccgg
ggaagaaaatga

DBGET integrated database retrieval system