KEGG   Desulfatibacillum alkenivorans: Dalk_3783Help
Entry
Dalk_3783         CDS       T00813                                 

Definition
(GenBank) Succinate-CoA ligase (ADP-forming), beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00020  Citrate cycle (TCA cycle)
dal00640  Propanoate metabolism
dal00660  C5-Branched dibasic acid metabolism
dal01100  Metabolic pathways
dal01110  Biosynthesis of secondary metabolites
dal01120  Microbial metabolism in diverse environments
dal01130  Biosynthesis of antibiotics
dal01200  Carbon metabolism
Module
dal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dalk_3783
   00640 Propanoate metabolism
    Dalk_3783
   00660 C5-Branched dibasic acid metabolism
    Dalk_3783
Enzymes [BR:dal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dalk_3783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp Citrate_bind Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ACL05470
JGI: Dalk3783
UniProt: B8FLW6
Position
4775073..4776233
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQAKELFANYGVPVPKGKPVFSVDEAVEAAKELGDFPVVVKAQIHAGGRGKGGGV
KLAQNIDEVKTIAGEILGMQLVTHQTGPEGQKVQKLLVEQGLDIAKELYFSIIVDRATAK
IVIMCSEAGGMDIEEVAASTPEKIIKVPVDPLLGVQGYHCRQAAYRLNLPPAAIKPFIKM
VQGLYKMFMDTDCSLLEINPLVLTGDDGIIALDAKINFDDSALYRHKDIQEYRDLDEEEP
LEVEASKFNLNYIKMDGNVGNMVNGAGLAMATMDIIKQAGAEPANFLDVGGGANAEQVEN
GFRIILSDKNVKGILINIFGGILRCDVLASGVVEAAKKVGLNVPVVVRMEGTNVEEGRRI
LAESGLNLTGAEDLKDAAAKVAQIVQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcatgagtaccaggcaaaagaactgtttgctaattacggcgtgccggttccc
aagggcaaacctgtcttttccgtggacgaagcggtggaggcggccaaggaactgggagat
tttcctgttgtagtcaaagcgcagattcatgcaggcggccgcggaaaaggcggcggcgtc
aaattggctcagaatattgacgaagttaaaaccatagccggcgaaattctcggcatgcaa
ctggtcacccatcagacggggcctgagggccaaaaggtccaaaagctcctggtggaacag
ggcctggacattgccaaggaactgtatttttccattatcgtggacagggcaacggccaag
atcgtcatcatgtgcagcgaagcaggcggcatggatatcgaggaagtggctgcatccacg
ccggaaaaaatcatcaaggttcccgtggatccgcttttgggagtccaggggtaccactgc
aggcaggccgcctaccgtttgaacctgcctcctgcggcgatcaagccctttatcaagatg
gtgcagggcctgtacaagatgttcatggacacggattgctcgcttcttgaaatcaatccc
ctggtcctgaccggcgacgatggcatcatcgccctggacgccaagatcaattttgacgac
agcgccttgtatcgtcataaggatattcaggaataccgagatcttgacgaggaagagccc
ctggaagtggaagcctccaagttcaacctcaactacatcaaaatggacggaaacgtgggc
aacatggtcaacggcgcaggcctggccatggccaccatggacatcatcaagcaagccggg
gccgagcccgccaactttttggacgtgggcggcggagccaacgccgagcaggtggaaaac
ggcttccgcatcattttgagcgacaagaatgtcaagggcatcctgattaatatattcggt
ggaattctccgttgcgatgttttggccagcggcgtggtggaagcggccaaaaaggttggc
ctgaacgtgccggttgtggtgcgtatggaaggcaccaatgtggaagaggggcgcagaatc
cttgcggagagcggcctgaatctcaccggcgccgaggaccttaaggacgctgcggccaag
gtcgcccagatcgttcagtaa

DBGET integrated database retrieval system