KEGG   Desulfatibacillum alkenivorans: Dalk_3986Help
Entry
Dalk_3986         CDS       T00813                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dal00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:dal00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5017814..5018800
Genome map
AA seq 328 aa AA seqDB search
MNIEDLAGQRLMVGYDGTTLNDQLREYIREYRVGGLIFFARNLIEPKQIEQLCRDSQAYA
KDQGLPPLLIAVDQEGGPVARLTPPYTQFAGNPGIKSEEDAKEYARVMAKELLEAGFNMN
MAPVMDVVPPDFDSIMIGRAFEGGPDEVARLGGYVIQYLQEYGVLAVAKHFPGIGRTTLD
SHLELPYSHAPRAQLEAEDLVPFREAVRKQASGVMFSHILYTDLDPDWPASISPAIVSLL
REDMGYTGIIMTDDLDMGAVAKQFPIETVVEQFMRSGSDLALICHPGPNIKTAFNIIRKG
LESDSTLLEMGRASVQRMLAVKQGIGLP
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaggatctcgccggccaacggcttatggtcgggtacgacggaaccaccctg
aacgaccaactgagggaatacatccgggaataccgggtgggcgggctgatttttttcgcc
cgaaatctgattgagcccaaacagatcgagcagctttgccgcgattcccaggcttatgca
aaagatcagggcctgccgcctttgctcatcgccgtggaccaggagggcggacccgtggcg
cggctaacgccgccgtacacgcagtttgcgggcaatcccggcatcaagtccgaagaggac
gccaaggaatacgcccgggttatggccaaagagctgctggaggcgggattcaacatgaac
atggcgcctgtcatggacgtggttcctccggattttgacagcatcatgatcggccgggcc
tttgaaggcgggccggacgaggtcgcccggctgggcggctatgtcatccaatatttgcag
gagtacggcgttctggccgtggccaagcattttcccgggattggccgcaccactctggat
tcccatttggagctgccctactcccacgcgccccgcgcccagctggaggccgaggatttg
gttccttttcgggaagccgttagaaagcaggcgagcggggtcatgttctctcatattctg
tatacggacctggacccggattggccggccagcatttccccggctatcgtctccctgttg
cgggaagacatgggctatacaggaatcatcatgaccgacgacctggacatgggggccgtg
gccaagcaatttcctattgaaactgtcgtagagcagttcatgcggtcgggctcggatttg
gccttgatttgccaccccggccccaacataaaaacggcttttaatattattcgcaagggc
ctggaatcggactcgaccctgttggaaatgggccgggcttccgtgcaacggatgctggcc
gttaaacaggggattggactgccttga

DBGET integrated database retrieval system