KEGG   Desulfatibacillum alkenivorans: Dalk_4009Help
Entry
Dalk_4009         CDS       T00813                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00860  Porphyrin and chlorophyll metabolism
dal01100  Metabolic pathways
dal01110  Biosynthesis of secondary metabolites
dal01120  Microbial metabolism in diverse environments
Module
dal_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dalk_4009
Enzymes [BR:dal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Dalk_4009
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dalk_4009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ACL05695
JGI: Dalk4009
UniProt: B8FJM6
Position
complement(5040485..5042002)
Genome map
AA seq 505 aa AA seqDB search
MGKVYLIGAGPGDVGLITVKGLDCVKTADVVVYDYLASPRLLAYAREDAEIIYVGKKGGD
HTLSQDGINALLVEKAKAGKTVARLKGGDPFIFGRGGEEAEVLKEQGQAFEIVPGVTSAI
AAPAYAGIPLTHRKHTATVAFVTGHEDPTKDESNIDWAKISTGIGTIVFLMGIKNLPMIT
KRLMDNGRAPQTPVALVRWGTTPGQETVTGTLETIVDIAQKAKIKPPAVIVVGEVVDLRP
VLNWFETKPLFGQKILVTRSRKQASALVEKLADLGADCVETPTIELVPPKDPKPLEDAVD
NIAAYDWVVLTSVNGVDYFFDCLFSKGKDARALANAKVAAIGPATSAKLREYGLVTDIVP
KTYRAESVVEAFLQEDMKDKKVLLPRAAQARPILPVELKKMGALVDEVPAYETVQASQDQ
AQVLWERLESGEITMTTFTSSSTVSNFVALFDKEKLLKVMEGVKTASIGPITSDTARDLG
LKVDMEAEAYTIDGLVQAILDGVGK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagtgtatctcatcggggctggccccggagacgtaggccttatcacggttaag
ggcctggattgcgtaaaaaccgcggatgttgtcgtctacgattacctggcgtctcccagg
ctgctggcctacgcccgggaagacgcggaaatcatctacgtgggcaaaaagggcggggac
cacaccctttcccaggacggcatcaacgcccttttggtggaaaaagccaaggcagggaag
accgtggcgcgcttgaaaggcggcgacccttttattttcggacgcggcggcgaggaagcc
gaagttctgaaggaacaaggccaagcctttgaaatcgtgcccggcgtcacctcggccatt
gcagccccggcttatgcaggcattcccctgacccataggaagcatacggccaccgtagcc
tttgtcaccggccacgaagacccgaccaaagacgaatccaacatcgattgggccaaaatt
tccacgggaatcggcaccatcgtgtttttgatgggcatcaagaatctgcccatgatcacc
aaacggcttatggacaacggccgcgctccccaaaccccggttgccctggtgcgttgggga
accactcctggccaggaaacggtcacgggaaccctggaaaccatcgtggacatcgcccaa
aaggcgaaaatcaagccgccggccgtcatcgtggtgggcgaggtggtggatctgcgcccc
gtgcttaactggtttgaaaccaagcccctgttcggccagaaaatcctggtcacccgcagc
cgcaagcaggccagcgcgttggtggaaaagctggccgatctcggcgccgactgcgtggag
actccgaccattgaactggttccgcccaaggaccccaaacccctggaagacgcggtggac
aacatcgccgcctatgactgggtggtcctgaccagcgtgaacggcgtggattattttttc
gactgcctgttttccaaaggcaaggacgcccgcgccctggccaacgccaaggtggcggcc
atcggtccggccacgtcggccaaattgcgggaatacggcctggttacggacatcgtgccc
aagacataccgcgccgagtccgtggtggaagccttcctgcaggaggacatgaaggataaa
aaagtgcttctgccccgagccgcccaagcccgccccatcctgcctgtggagttgaaaaaa
atgggcgccctggtggacgaggttccggcttacgaaacggtccaggcttcccaggatcag
gcccaggttttgtgggaaaggctggaatccggcgaaattaccatgaccaccttcacaagc
tcgtccacggtgagcaactttgtggccttatttgacaaggaaaagctcctgaaggtcatg
gaaggcgttaaaaccgccagcatcggccccataaccagcgacacggcccgagaccttggg
cttaaggtggacatggaggcggaagcctacaccatcgacggcctggtccaggccattttg
gacggagtcggcaaataa

DBGET integrated database retrieval system