KEGG   Desulfatibacillum alkenivorans: Dalk_4098Help
Entry
Dalk_4098         CDS       T00813                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dal01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dal00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5146277..5147545)
Genome map
AA seq 422 aa AA seqDB search
MDYTQAFKAVEGNKDYLVKTLQELLAVDTTLPPGSNYRQFLEVVEPHFLNLGFSVKRVTV
PDELVKQIPLSLSGPRENLVASLDLQKPKVTAYAHMDVVPADDAWTCDPFNGKVEDGKIY
GRGAVDMKGSIACFLGAMKVLKDLGVEPKFSVDCLLCTDEEIGVYPGARYLAEQGYFSNH
ILWLELGYLKPGVIMETLGTAGNLQCRITAVGKSCHSGMNYLGVNAIEEMIPILNELVEL
KKEVQARLSHLPAFPDPRNPYDMLTPMFNLAIIKGGIKENIVPGVCELAINRRYTVDENL
DEVMEEIRRAVARGQEKSRLLDVKTKFIQMYPPMEINLENPAAVKAREARKAVHGDLPIV
AGGISASSDLGFVAQNIPPEDLQVAILGLFRADNMLAHCADEFTYVDDLVAMTKELVYYL
GF
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggattacacacaggcctttaaggccgtggaaggcaataaggattatctggtaaaaacg
cttcaggagcttctggctgttgacaccacactgcctccgggaagcaactaccgccaattt
ctggaagtggtcgagccccattttttaaacctggggttctccgtcaaacgagtgaccgtt
cctgacgagctggtaaagcaaatccctctgagtctttccggcccgcgggaaaatctcgtg
gcctccctggacttgcaaaagcccaaagtcacggcatacgcccatatggacgtggttccc
gcggacgacgcctggacctgcgatcctttcaacggaaaggtggaggacggtaaaatctac
ggccgtggcgccgtggatatgaaaggctccatcgcctgttttctgggcgccatgaaggtc
ttgaaggatttgggcgtcgagccgaaattctccgtggactgcctcttgtgtacggacgag
gagatcggggtgtatcccggcgccagatacctggctgagcaggggtatttttccaaccat
attttatggctggaattggggtatctgaagcccggcgtgatcatggaaaccctgggcacg
gcaggcaacctgcaatgccgcatcacggccgtgggtaaaagctgccattcgggcatgaat
tacctgggcgtcaacgccatcgaggaaatgatccccatactcaacgaactggttgagttg
aagaaagaggttcaggctcgcttgtctcatctgcccgcctttcccgatccaagaaatcct
tacgacatgttgacccccatgttcaacctggccattataaaaggcggcatcaaggaaaac
atcgttccaggagtttgcgagttagccattaatcgccggtacaccgtggacgaaaacctg
gacgaggtcatggaggaaatccgccgggccgtagccaggggccaggaaaaatccaggctg
ttggacgtgaaaaccaagtttatccaaatgtatccgcccatggaaatcaacctggagaac
ccggccgcggtcaaagcccgggaagcccgcaaggccgtgcacggggatctgcccatcgtg
gctggaggcatatccgcctcgtcagacttggggtttgtggcccagaacatcccacctgag
gatttgcaggtggctattctgggattattccgggcggacaacatgttggcccattgcgcg
gatgaattcacttatgtggacgaccttgtcgccatgaccaaagagcttgtttattatttg
ggattttag

DBGET integrated database retrieval system