KEGG   Desulfatibacillum alkenivorans: Dalk_4295Help
Entry
Dalk_4295         CDS       T00813                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
dal  Desulfatibacillum alkenivorans
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Dalk_4295
Enzymes [BR:dal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Dalk_4295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5390779..5392356
Genome map
AA seq 525 aa AA seqDB search
MDYDFVVVGSGFGGGVSALRLTEKGYKVAVIEQGRRIGPKDVQAADEKPLRNFFWMPAAK
MNGFFTQTIFRHVQIVGGVGLGGGSLVYAAVLLKPKTGFFKDPVWSNFGVDWEQELEPHY
EEVKRMLGLTNNPNFDLQDEYLKKTAHTMGAQDTYGPTPNGIYFGKPGVTVKDPFFGGEG
PDRTGCELCGDCLSGCGKGAKNSLDKNYLFLAEKKGAEILTSRKVSHVEPMEGGYRLHLA
DPMKPKKTYPSITAKKVVLAGGVLGTLELLFRSRDVKKTLPKVSPLLGRVVRTNSEAIVA
SLSRNPDEDITKGSAISSHFYPDDHTHITQNRFPDGYDFMRYYLGPMVDEPNPAKRAFKT
LWAMVKNPIRSMASIFAKNWRKRISVLTVMQHMDNQISLVYRRGLFSWFKKSLHSKIPEG
QQRAPAFLPIANKAARAYAQASGGDPLNVTMESLLNLSSTAHILGGCHMGTSPENGVIST
DHEVLGYPGLYVADGAAVSANVGVNPSLTIAALAERAMSRIEAKQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggattacgattttgttgttgtaggaagcggctttggaggcggcgtatcagccttacgc
cttactgaaaaagggtacaaggtcgccgttattgaacaaggcaggagaataggcccaaag
gacgtgcaggcggcggatgagaagccgttgaggaatttcttctggatgccggcggctaaa
atgaacggctttttcacccaaaccatatttcgccacgtgcagattgtgggcggcgtgggc
ttgggcgggggaagcctggtctatgcggccgtgctgttaaagcctaaaaccggttttttc
aaagacccggtctggagcaatttcggcgtggattgggaacaggaactggaaccccattac
gaagaagtaaagcgcatgcttgggcttaccaataatcccaatttcgacctgcaggacgaa
tacctgaaaaagaccgcccacaccatgggcgcgcaggatacttacggccccacgcccaac
ggcatatacttcggcaagcccggcgttacggtcaaggatccgtttttcggcggcgagggg
cctgatcgaaccggctgcgaactttgcggagactgcctttccggctgcggcaagggcgcc
aaaaacagcctggacaaaaactatttgtttttagcggaaaagaagggcgccgaaatcctc
accagccgtaaggtttcccacgttgagcccatggagggcggataccgcctgcaccttgcg
gatcccatgaagccgaaaaaaacctatccgtccatcacggccaaaaaggtggtgctggcc
gggggcgttttgggcaccctggaacttttgttccgaagccgggacgtcaagaagaccctg
cccaaggtttcgcccctgctgggcagggtggtgcgcaccaacagcgaggccattgtggcc
agcctatccaggaaccctgacgaagacatcaccaagggctcggccatctccagtcatttt
tacccggacgatcatacgcatatcacgcagaaccgctttcccgacggatacgactttatg
cgctattacctgggccccatggtggacgagcccaacccggcgaaaagagctttcaagacc
ctgtgggccatggtcaaaaaccctattcggtctatggcttccattttcgctaaaaattgg
cgcaagcgcatctcggtgctcacggtcatgcagcacatggacaaccagatatccctggtg
taccgccgcggcctgttttcctggtttaaaaaatcgctccattccaagattcccgaaggc
cagcagcgggcgcccgcgttcctgccgatcgccaacaaggcggccagggcttacgcccag
gcctcgggcggcgatcctctgaacgtcaccatggaaagcctgcttaacctgtcgtccacg
gcccatatcctggggggatgccatatgggaacctcgcccgaaaacggggtcatcagcacg
gatcacgaggtgctgggctatccaggattatacgtagcggacggcgctgcggtttccgcc
aacgtcggcgtgaacccgtctttgaccatagcggccctggcggaaagagccatgtccaga
atcgaggcgaaacaatga

DBGET integrated database retrieval system