KEGG   Desulfatibacillum alkenivorans: Dalk_4397Help
Entry
Dalk_4397         CDS       T00813                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dalk_4397
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dalk_4397
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dalk_4397
Enzymes [BR:dal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dalk_4397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5502272..5503777
Genome map
AA seq 501 aa AA seqDB search
MKLQDFPQEIRGSILPKPGGKIIYRCLSCNEEFGIEKLLYTCPSCGQVLLLHDMEFDRLK
QRTPEEWRKILDYRKMSNEPAVSGIYRYHEFIGPIVPLDCVVYLGEGHTPLVEAGKQLQE
KAGGRFFYKNDGQNPSASFKDRGMASALSYINFLIKSGLVKDVLAVCASTGDTSASAALY
ASYLQPDIKSAVLLPHGKVTPQQLGQPLGAGAQVFEIPGVFDDCMKVVEALAENYNVALL
NSKNAWRILGQESYSYELAQDFDYDMSSKVIFVPIGNAGNITAIMSGFLKFYRCGIIDAL
PKVVGVQSHHADPVYKYYLEPDEDKRKFVPVTVEPSVAQAAMIGNPVSMPRVISLVRDYN
EQSGKKNVFVVQVTEQEIMDWQLTANRFGHVACTQGGECLAGMTAALKQGVMDSSETAVL
DSTAHALKFSGFQEMYFDDAFPPEFGVTPKPELQNRPVLVRPADLEKVPAPGKPLEREEF
ERFVERTSQDIAEKLNLSPRE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccaggattttccccaagagatcaggggaagcatcctgcccaagccgggcggg
aaaattatttacaggtgcctgtcctgcaacgaggaattcggcattgagaagctgttgtac
acctgccccagctgcggccaggtgctcttgctccatgacatggagttcgaccgcctgaaa
cagcgcactcccgaggaatggcgcaaaattctggactatcgcaagatgtccaacgaaccc
gccgtttccggcatttatcgctatcatgaattcatcggacccatcgtgccgctggattgc
gtggtctacctgggcgaggggcacacccccctggtggaggcgggcaaacagcttcaggag
aaggccgggggccgctttttctataaaaacgacgggcaaaatcccagcgcctcttttaaa
gaccggggcatggccagcgccctgtcttatattaattttctgatcaagtccgggttggtg
aaagacgtcctggccgtgtgcgcctccaccggagacacatccgcctcggcggccctttac
gccagctacctgcagccggacataaagtccgccgtgcttttgcctcacggcaaggtcacg
ccccagcaattgggccagccccttggcgcgggcgcccaggtgttcgagattccaggcgtg
ttcgacgactgcatgaaagtggtggaagccctggccgaaaattataacgtggccttattg
aactccaaaaacgcctggcgcattctggggcaggaatcctattcctatgaactggcccag
gatttcgactacgatatgtccagcaaggtcatattcgtgcccatcggaaacgccggcaac
atcacggccatcatgtccggcttcctgaagttttaccggtgcggcataattgacgctctg
cccaaggtggtgggcgttcagtcccaccacgccgaccctgtttacaaatattacctggag
cccgacgaggacaaacgcaaattcgttcccgtgaccgttgaacccagcgtggcccaggcc
gccatgattggcaacccggtttccatgcccagggtcatttccctggtgcgggattataac
gagcaatccgggaaaaagaacgtgttcgtggtccaggtgaccgaacaggaaatcatggat
tggcagcttacagccaaccgcttcggccatgtggcgtgcacccagggaggggagtgcctc
gcaggcatgaccgccgccctgaagcaaggcgtgatggactcctcggaaaccgcggtgctg
gattccacagcccacgccttgaagttctccggctttcaggaaatgtactttgatgacgcc
tttccgccggaattcggcgtaacgcccaaacccgagcttcaaaaccggcctgttctggtc
cgtccggcggacctggaaaaggttccggcgccgggaaaaccccttgaaagagaagagttt
gagcggtttgttgaaagaacctcccaggatattgcggaaaagctcaatctgtcgcccagg
gaataa

DBGET integrated database retrieval system