KEGG   Desulfatibacillum alkenivorans: Dalk_4693Help
Entry
Dalk_4693         CDS       T00813                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00071  Fatty acid degradation
dal00280  Valine, leucine and isoleucine degradation
dal00281  Geraniol degradation
dal00310  Lysine degradation
dal00360  Phenylalanine metabolism
dal00362  Benzoate degradation
dal00380  Tryptophan metabolism
dal00410  beta-Alanine metabolism
dal00627  Aminobenzoate degradation
dal00640  Propanoate metabolism
dal00650  Butanoate metabolism
dal00903  Limonene and pinene degradation
dal01100  Metabolic pathways
dal01110  Biosynthesis of secondary metabolites
dal01120  Microbial metabolism in diverse environments
dal01130  Biosynthesis of antibiotics
dal01212  Fatty acid metabolism
Module
dal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dalk_4693
   00650 Butanoate metabolism
    Dalk_4693
  Lipid metabolism
   00071 Fatty acid degradation
    Dalk_4693
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dalk_4693
   00310 Lysine degradation
    Dalk_4693
   00360 Phenylalanine metabolism
    Dalk_4693
   00380 Tryptophan metabolism
    Dalk_4693
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dalk_4693
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Dalk_4693
   00281 Geraniol degradation
    Dalk_4693
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dalk_4693
   00627 Aminobenzoate degradation
    Dalk_4693
   00930 Caprolactam degradation
    Dalk_4693
Enzymes [BR:dal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dalk_4693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACL06371
JGI: Dalk4693
UniProt: B8FCU0
Position
complement(5804683..5805486)
Genome map
AA seq 267 aa AA seqDB search
MGLIYEKRNNIAYLTFNRPEARNAMDPETILQLIDAWKDYAEDKEMRCAILTGTGDKVFC
SGADLGKLIPLFTGAKPAETDAEKACQSDPMIVNKAILREYPLYKPVIAAINGHAIAGGM
EALYATDIRIAAEGVKFGLQEVKWAIFPAGGSSIRLPRQLPYARAMEILLTGELMEAEEA
LRLGFINKIVPREKVMEEAERYAGIICKNGPLAVEAIKKSVIENRGKPLSEGLQRELELA
LPVFMSKDAQEGPKAFKEKREPKFEGK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgatctacgaaaaaagaaacaatatcgcttacctgacttttaaccggcccgag
gccagaaacgccatggacccggagaccatcctgcaattgatcgacgcatggaaggattac
gcggaagacaaggaaatgcgctgcgccattctgaccgggaccggcgacaaggtgttttgc
tccggcgcggacctgggcaagctgatacccctctttacgggcgccaagcctgcggagacg
gacgcggaaaaagcctgtcagagcgatcccatgatcgtgaacaaagccatcctgcgggaa
tatcctctgtataaaccggtcattgcagccatcaacggccacgccatcgccggcggcatg
gaggcgctctacgcaacggacatccgcatcgccgccgaaggggtcaaattcggcctgcag
gaagtcaaatgggccatctttccggccggagggtcgagcatccgcctgccccggcaattg
ccttacgcccgggccatggagattctgctgaccggagagttgatggaggcggaggaagcc
ttgcgcttaggctttatcaacaagatcgttcccagggaaaaagtgatggaagaggcggaa
agatacgccggcatcatctgcaaaaacggcccccttgccgtggaagccatcaagaaatcc
gtcatagaaaaccgcggcaagccgttgtccgaaggcctgcagagggagttggagctggcc
ctgcccgtgtttatgagcaaggacgcccaggaaggccccaaggcttttaaggaaaaacgc
gagcccaagtttgaggggaagtaa

DBGET integrated database retrieval system