KEGG   Desulfatibacillum alkenivorans: Dalk_4766Help
Entry
Dalk_4766         CDS       T00813                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00072  Synthesis and degradation of ketone bodies
dal00650  Butanoate metabolism
dal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Dalk_4766
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Dalk_4766
Enzymes [BR:dal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Dalk_4766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Glucokinase Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ACL06444
JGI: Dalk4766
UniProt: B8FD13
Position
complement(5888631..5889491)
Genome map
AA seq 286 aa AA seqDB search
MEETIKPEDAKEPAIGSEDILILSDPQFNSSNVCIVTGAGTGIGRATAIAAAANQLMTIG
LDINEEEGRKTQKLARDMGGQMVFLPCDLSRDADMDRAVKEAAKLGAIKYLANIAGIQHI
DSVENFPMDKYDQMQSLMLRAPFYLSKLAIPHMKKSKDGCGVIANMASVHAHICTKNKPV
YNITKFGLRALSQSISAEGEGRVRSFTLSTGFVKTPLALNQINAQATQRGITPEEVVRDV
MMGTSRIKEMMSPIEVANLMLFGFSRFAKYLVGGDMLFDGGMVLTY
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaccatcaaaccggaagacgccaaggaaccggccatcgggagtgaggatatt
ctaatcctgtcagacccgcaattcaacagttccaacgtctgcatcgtcaccggcgccggc
accggcatcggccgggccacggccattgccgccgcggcgaaccaactgatgaccatcggc
ctggacatcaatgaggaagaaggccgcaagacgcaaaagctggcccgggacatgggcggg
caaatggtttttttgccgtgcgatttgtccagggacgcggacatggacagggccgtaaag
gaagcggccaagctgggcgccatcaagtatctggccaacatcgcgggaatccagcacatc
gactccgtcgaaaatttccccatggacaaatacgatcagatgcaatccctgatgcttagg
gcgcctttttatctttccaagctcgccatcccccacatgaaaaaaagcaaagacggatgc
ggcgtcatcgccaatatggcctcggtgcatgctcatatctgcaccaagaacaagccggtc
tacaacatcaccaaattcggattgcgcgccctgagccagtccatttcggccgaaggtgaa
ggccgggtccgttcctttacgctcagcacgggttttgtcaaaacccccctggcgctgaac
cagatcaacgcccaggcgacgcagcgcggcatcacgcctgaagaggttgttcgcgatgtc
atgatggggacgtcccggatcaaggaaatgatgtcgcccattgaggttgccaatctgatg
cttttcggcttttcgcggttcgccaaatatctcgtgggaggggatatgctgtttgacggc
ggcatggtcctcacctactga

DBGET integrated database retrieval system