KEGG   Desulfatibacillum alkenivorans: Dalk_5067Help
Entry
Dalk_5067         CDS       T00813                                 

Definition
(GenBank) Putative heterodisulfide reductase, subunit B
  KO
K03389  heterodisulfide reductase subunit B2 [EC:1.8.7.3 1.8.98.4 1.8.98.5 1.8.98.6]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
dal00680  Methane metabolism
dal01100  Metabolic pathways
dal01120  Microbial metabolism in diverse environments
dal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dal00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Dalk_5067
Enzymes [BR:dal01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.7  With an iron-sulfur protein as acceptor
    1.8.7.3  ferredoxin:CoB-CoM heterodisulfide reductase
     Dalk_5067
   1.8.98  With other, known, physiological acceptors
    1.8.98.4  coenzyme F420:CoB-CoM heterodisulfide,ferredoxin reductase
     Dalk_5067
    1.8.98.5  H2:CoB-CoM heterodisulfide,ferredoxin reductase
     Dalk_5067
    1.8.98.6  formate:CoB-CoM heterodisulfide,ferredoxin reductase
     Dalk_5067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCG
Motif
Other DBs
NCBI-ProteinID: ACL06738
JGI: Dalk5067
UniProt: B8FDV7
Position
6250154..6251023
Genome map
AA seq 289 aa AA seqDB search
MNYALFLGCNIPARVPQYDQAARAVLNRLGVEVLDIPDFNCCGYPMRDTDSQAFLLSSAR
NLALAEQSGLDMMVLCKCCFGALKAASYALAQDSALKNEINALLEPEKLSYQGNVKVKHF
FSVLKDSVGLDEVKKTVERPFQGLRIATHYGCHALRPSSITEFDDPVNPSLFDKLVEATG
AESVDWAEKTDCCGAPLMGANDELSLKITGKKLKGARKAGAHFLCVGCPYCHMQFDTVQA
SFIKSEPGKGPMASILYPQLLGLSMGIDAEDLGLDNNCLDISSIKLFLK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcattgttcttgggatgcaatattccggctcgggtcccccaatacgatcag
gcggctcgtgcagtgctgaacagactgggcgtcgaggttctggatataccggatttcaat
tgctgcggatatcccatgcgggacacggattctcaggcctttttgctttcctcggcccgg
aacctggctttggccgaacagtcgggcttggatatgatggtgctgtgcaaatgctgcttt
ggcgccctcaaggccgcaagctacgcattggcgcaggactcggcccttaaaaatgaaatc
aacgccttgctggagccggaaaaactgtcttaccaggggaacgtgaaagtaaagcacttc
ttttccgtgctcaaagactccgtgggccttgacgaagtgaaaaagacggtggaacggcct
ttccagggcctgcgcatagcaacccattacgggtgtcacgccctgcgccccagttccatc
acggaatttgacgaccccgtcaatcccagtttgttcgataaactggtggaggccaccggc
gccgaaagcgtggattgggcggaaaaaaccgattgctgcggcgctccgctcatgggcgct
aacgatgagttgtccctgaagatcaccgggaaaaagctcaagggcgcacgcaaggcggga
gcccactttttgtgcgtaggctgcccctattgccatatgcaatttgacacggtgcaggct
tcctttataaaatcggagccgggcaaaggaccgatggcgtccatcctgtatccccaactc
ctgggcctgtccatgggcattgacgccgaggacctggggttggataataattgtttggac
atcagcagcatcaagctgtttctaaaataa

DBGET integrated database retrieval system