KEGG   Desulfatibacillum alkenivorans: Dalk_5067Help
Entry
Dalk_5067         CDS       T00813                                 

Definition
CoB--CoM heterodisulfide reductase
Orthology
K03389  
heterodisulfide reductase subunit B [EC:1.8.98.1]
Organism
dal  Desulfatibacillum alkenivorans
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dal01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:dal00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6250154..6251023
Genome map
AA seq 289 aa AA seqDB search
MNYALFLGCNIPARVPQYDQAARAVLNRLGVEVLDIPDFNCCGYPMRDTDSQAFLLSSAR
NLALAEQSGLDMMVLCKCCFGALKAASYALAQDSALKNEINALLEPEKLSYQGNVKVKHF
FSVLKDSVGLDEVKKTVERPFQGLRIATHYGCHALRPSSITEFDDPVNPSLFDKLVEATG
AESVDWAEKTDCCGAPLMGANDELSLKITGKKLKGARKAGAHFLCVGCPYCHMQFDTVQA
SFIKSEPGKGPMASILYPQLLGLSMGIDAEDLGLDNNCLDISSIKLFLK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcattgttcttgggatgcaatattccggctcgggtcccccaatacgatcag
gcggctcgtgcagtgctgaacagactgggcgtcgaggttctggatataccggatttcaat
tgctgcggatatcccatgcgggacacggattctcaggcctttttgctttcctcggcccgg
aacctggctttggccgaacagtcgggcttggatatgatggtgctgtgcaaatgctgcttt
ggcgccctcaaggccgcaagctacgcattggcgcaggactcggcccttaaaaatgaaatc
aacgccttgctggagccggaaaaactgtcttaccaggggaacgtgaaagtaaagcacttc
ttttccgtgctcaaagactccgtgggccttgacgaagtgaaaaagacggtggaacggcct
ttccagggcctgcgcatagcaacccattacgggtgtcacgccctgcgccccagttccatc
acggaatttgacgaccccgtcaatcccagtttgttcgataaactggtggaggccaccggc
gccgaaagcgtggattgggcggaaaaaaccgattgctgcggcgctccgctcatgggcgct
aacgatgagttgtccctgaagatcaccgggaaaaagctcaagggcgcacgcaaggcggga
gcccactttttgtgcgtaggctgcccctattgccatatgcaatttgacacggtgcaggct
tcctttataaaatcggagccgggcaaaggaccgatggcgtccatcctgtatccccaactc
ctgggcctgtccatgggcattgacgccgaggacctggggttggataataattgtttggac
atcagcagcatcaagctgtttctaaaataa

DBGET integrated database retrieval system