KEGG   Drosophila ananassae: Dana_GF10072Help
Entry
Dana_GF10072      CDS       T01059                                 

Definition
GF10072 gene product from transcript GF10072-RA
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dana_GF10072
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dana_GF10072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 140 aa AA seqDB search
MKAFIVLVALALAAPALGRTMDRCSLAREMSNLGVPRDQLARWACIAEHESSYRTGVVGP
ENYNGSNDYGIFQINDYYWCSPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQGW
SAWSTWHYCSGWLPSIDDCF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcatcgttttggttgcccttgctctggccgcccccgccctcggtcgcacc
atggaccgttgctccctggcccgcgagatgtccaacctgggcgtcccccgcgaccagctg
gcccgctgggcttgcattgccgagcacgagagctcctaccgtaccggagtggtcggcccc
gagaactacaacggctccaacgactacggcatcttccagatcaacgactactactggtgc
tctccccccagcggtcgcttctcctacaacgagtgcggcctgagctgcaacgccctcctc
accgacgacatcacccactccgtccgctgcgcccagaaggtcctcagccagcagggctgg
tccgcctggtccacctggcactactgcagcggatggttgccgtccatcgatgactgcttc
taa

DBGET integrated database retrieval system