KEGG   Drosophila ananassae: Dana_GF10076Help
Entry
Dana_GF10076      CDS       T01059                                 

Definition
GF10076 gene product from transcript GF10076-RA
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 142 aa AA seqDB search
MKAVLLICVLALAAPVILARTMDRCSLAREMAKRGVPRGELARWACIAEHESSYRTGVVG
PTNPDGSNDYGLFQINDRYWCQPASGKFSYNGCRINCNDLLTDDISNSVRCAQAVMGAQG
WSAWSVWRFCSGYLPPIDDCFK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtcttactaatatgtgttctggctctggcagccccggttatcctggcccgc
accatggaccgatgctccttggcccgagagatggccaaacggggtgtaccccgcggcgag
ctggccaggtgggcgtgtatcgccgagcatgagagctcctaccgcactggagtggtggga
cccacgaatccggatggatccaacgactacggactcttccaaatcaatgatcgctactgg
tgccagccggccagcggaaaattctcctacaatggttgccgcataaactgtaacgatttg
ctaaccgatgatatttccaactccgtgagatgtgctcaggcagttatgggagcccaggga
tggtcagcctggtccgtttggcgtttctgcagcggatatctgccaccaatcgacgactgt
ttcaaatag

DBGET integrated database retrieval system