KEGG   Drosophila ananassae: Dana_GF10076Help
Entry
Dana_GF10076      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dana_GF10076
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dana_GF10076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys SLT Transglycosylas
Motif
Other DBs
NCBI-GeneID: 6492952
NCBI-ProteinID: XP_001956727
FlyBase: FBgn0087117
UniProt: B3M554
Position
Unknown
AA seq 142 aa AA seqDB search
MKAVLLICVLALAAPVILARTMDRCSLAREMAKRGVPRGELARWACIAEHESSYRTGVVG
PTNPDGSNDYGLFQINDRYWCQPASGKFSYNGCRINCNDLLTDDISNSVRCAQAVMGAQG
WSAWSVWRFCSGYLPPIDDCFK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtcttactaatatgtgttctggctctggcagccccggttatcctggcccgc
accatggaccgatgctccttggcccgagagatggccaaacggggtgtaccccgcggcgag
ctggccaggtgggcgtgtatcgccgagcatgagagctcctaccgcactggagtggtggga
cccacgaatccggatggatccaacgactacggactcttccaaatcaatgatcgctactgg
tgccagccggccagcggaaaattctcctacaatggttgccgcataaactgtaacgatttg
ctaaccgatgatatttccaactccgtgagatgtgctcaggcagttatgggagcccaggga
tggtcagcctggtccgtttggcgtttctgcagcggatatctgccaccaatcgacgactgt
ttcaaatag

DBGET integrated database retrieval system