KEGG   Drosophila ananassae: Dana_GF10175Help
Entry
Dana_GF10175      CDS       T01059                                 

Definition
GF10175 gene product from transcript GF10175-RA
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dan  Drosophila ananassae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dana_GF10175
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dana_GF10175
   00620 Pyruvate metabolism
    Dana_GF10175
   00640 Propanoate metabolism
    Dana_GF10175
Enzymes [BR:dan01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dana_GF10175
Lipid biosynthesis proteins [BR:dan01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dana_GF10175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 670 aa AA seqDB search
MPAEKSIYDPNPAISQNAYISSFEEYKKFYQESLDDPAEFWSRVAKQFHWETPADPQKFL
QYNFNISKGPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRK
LLEEVCRFANVLKDHGIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLA
ERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQ
ADHVEEDIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTA
GYLLYAATTFKIVFDYKPGDIYWCTADVGWITGHTYVVYGPLANGATSVIFEGTPFYPGN
DRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYY
RNIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDECGIEIKGE
GEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDM
LNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDQKLISDL
KKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQ
LFANRPVEAK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgccagcggaaaaatcaatatacgatcctaatccggccatcagccaaaatgcgtacata
tccagcttcgaggagtacaagaagttctaccaggagtccttggacgatccggcggagttc
tggtcccgcgtggccaagcagttccactgggagacgcccgccgaccctcagaagtttctc
caatacaacttcaacatctccaagggacccatttccatcaaatggatggagggagcctcg
actaatctgtgctacaatctcctggatcgcaatgtccggaacggattgggtgaccagatt
gcctactactgggagggcaaccaccccgacgactactcccgcggcctcacctaccgaaag
ctgctcgaggaggtctgccggttcgccaatgtgctgaaggaccatggcatccggaagggc
gatcgcgtgtccatctacatgcccatgatcctggagctgcccattgccatgctggcctgt
gcccgtatcggtgccgtgcactcgattgtctttgccggattctcgccggactccttggcg
gagcggatgttcgactgcaaggccaagttgctcatcacggcggacggagcttggcgtggt
gagaagcccctgtacctgaaggcgctctgcgacacggccctggagaaggtcgaggagatg
ggccactccgtggagaagtgcattgtggtgtcgcatctgaagcgcgtgactccctgccag
gcggatcatgtcgaggaggatatcccatggaccgacgatcgggactactggtggcacgag
gagatggaggataaggagccggcctgctatcccgagtggatggacgccgaggatccgctg
ttcatgctctacaccagtggctccactggcaagcccaagggcgtgctccacaccaccgcc
ggctacttgctctacgcggccaccacattcaagattgtctttgattacaagccgggcgat
atctactggtgcaccgccgatgtgggctggatcactggacacacctacgtggtctacgga
cctctggccaatggagccacttcggtgattttcgagggtactcccttctatcccggcaat
gaccgctactggagcgttatcgacaagtacaaggtgactcagttctacacggctcccacg
gccatccgagccctgatgaagttcggcgaaggaccagtgctcaagcataatctaagtggt
ctcaaagttttgggcagcgtcggtgaacccatcaatccggaagcctggctctggtattat
cgtaacattggcaaggagcagtgctccattgtggacactttctggcagacggaaactgga
ggtcatgtcataacacctctaccaggagccactcccatgaaacctggctcagcttcattc
cccttctttggtgtgaaacccactctgctggatgagtgcggcattgagatcaagggcgag
ggtgagggctacttggtgttctcccagccttggcccggcatgatgcgtaccttgtacaac
aaccatgaacgcttcgaggacacctacttctccaagttccctggctactactgcactggc
gatggcgcccgtcgcgatgctgatggctatctctggatcactggccgtgtggatgacatg
ttaaacgtctctgggcatctgatgtccaccgctgaggtcgaatctgtcctgacagaacat
ccccgcgtggctgaatccgccgtggtttcccgtccacatccagtcaagggcgagtgcctc
tactgcttcatcactcccaatgagaacgaagttttcgatcagaaactaatctccgatctt
aaaaagatggtgcgcgaacgcatcggaccctttgccatgccggatgtcattcagaatgcc
cccggcttgcccaagacccgctccggaaagattatgcggcgagtgctgcgcaagatcgcc
gtaaacgatcgcaatgtgggcgacacctcgaccctggccgacgagcagattgtggagcag
ctattcgccaaccgacccgttgaggccaagtaa

DBGET integrated database retrieval system