KEGG   Drosophila ananassae: Dana_GF10220Help
Entry
Dana_GF10220      CDS       T01059                                 

Definition
GF10220 gene product from transcript GF10220-RA
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 826 aa AA seqDB search
MEELRKHLSKINVPCGSGSAAPPIYKDECVYSYDNPETPTGLYVCLNSFLGFGEAYVREY
ASKTGNQVFLHIQRVKTLKEGADCNPEMESETEAGPERKITRLAIGVEGGYNESDMAKKY
EIKDTYSIVVAPQLDKKLPYPDPELPMRVTQAVEAILAADSAISKLEKATLMGTWDGEVR
QPSKYAEDLQQLDNGKKIPPSGWQCQKCDLTNNLWLNLTDGAILCGRKFFDGSGGNDHAV
EHYRETGYPLAVKLGTITADGKSDVFSYPEDDMVLDPHLERHLSHFGINMAAMKKSEKSM
VELELDINQRIGEWSALTESESELQPLAGPGYTGMKNLGNSCYINSVMQVLFVIPDFQQR
FVGTGAERYFSQFPNDPANDFNIQMAKLGTGLQSGKYSSIAANTLDTEHATGISPAMFKN
IVGKNHPDFSTKQQQDANDFYLHLLTLLDRNSRNQSNPADALKFLLEDRVECLASRKVKY
KTREEYSFRLPIPLEKATNLDEVKEFQEREKAARESGQRLVERDIVRHKVPLEACLERFF
GPELIEQFYSTAIEGKTNARKTTRLATMPDCLMIHLGKFTLGDDWVPKKLDVSVDMPDQL
DLSNWKSAGGLQAGEEPLPETATEEVKFVFDEAVMSELLTMGFPPEACKRACFHTKNTGL
EAASNWLMEHIADEDISEPFVVPNNQIGDCAAEQFVANPESLAMLMSMGFDERQAVAALK
ATDGNVERATDWIFSHADSIGVEEVAPAPAAPASSAGNSKTNYRDGGGKYKLVAFISHMG
TSSQVGHYVCHIRKQGEWVIFNDSKVAKSQNPPKDLGYLYLYMRDE
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggaggaactacgcaagcatttgtcaaagataaacgtgccctgcggctcaggatcggcg
gctccgccgatctataaggacgagtgcgtttactcgtacgacaacccagagacgcccacc
ggcttatacgtgtgcctgaatagcttcctgggctttggagaggcctacgtgcgggagtac
gcctctaagacgggcaaccaggtgttccttcacatccaacgggtgaaaactttgaaagaa
ggtgctgattgcaatccggagatggagtctgagaccgaggctgggccggaaagaaagatc
acacgtctagccatcggagtggagggcggatacaatgagtctgatatggccaagaagtac
gagattaaggatacctacagcatcgtagtggctcctcagttggacaaaaagctgccctac
ccggatccagagttgcctatgcgcgtcacccaggcggtggaggccattttggcggccgac
tctgccatttccaagctggagaaggccacgctgatgggcacatgggatggtgaggtgcga
cagccctccaagtatgcggaggacctgcagcagctggataatggaaagaagatacctccc
tccggctggcaatgtcagaagtgcgatctgaccaataacctttggctcaatttaactgac
ggtgccattctctgcggccgcaaattcttcgatggcagcggaggcaatgaccacgccgtg
gaacattaccgtgaaacgggctatcctctggccgttaagctgggcaccattactgctgac
ggcaagtcggacgtgttttcgtatccagaggacgacatggtgctggatccgcacttggag
cggcacctgtcccactttggcattaacatggcggcgatgaagaagagcgaaaagtcaatg
gtggagctggagctggacatcaatcagagaatcggggagtggtcggccttgaccgagagc
gagagcgagctgcagcctctggccggaccaggttacacaggcatgaaaaatctgggcaac
tcctgctacataaacagtgtgatgcaggtcctgttcgtcatcccagacttccagcagcgc
tttgtgggcaccggcgccgagcgctatttcagtcagttccccaacgacccagccaatgac
tttaatattcagatggccaagttgggaacgggcctgcagtccgggaagtacagtagcatt
gctgccaacaccctggacacggagcacgccacgggtatttccccagccatgttcaaaaac
atcgtgggcaagaaccaccctgatttcagtaccaagcaacagcaggatgctaacgatttt
tatctacatttactcaccttgctggaccggaattccaggaatcagtcgaacccagcagat
gccctgaagttcttgctggaggatcgggtggagtgcctggccagccgcaaggtcaagtac
aagactcgcgaggaatacagcttccgactgccaattccgctggaaaaagcaacgaacttg
gatgaggtgaaggagttccaggagcgggagaaggcggcccgtgaaagcggccagcgtttg
gttgagcgcgacatcgtcagacacaaggtgcctttggaggcttgcttggaacgcttcttc
ggcccagagctgatcgagcagttctattcgactgccattgagggaaaaaccaatgccaga
aagaccacacgactggccaccatgcccgactgcctgatgatccaccttggaaagtttacc
ttgggcgacgactgggtgccgaagaagctggatgtttcggtggacatgccggatcaactg
gatctgagtaactggaaatccgctggaggtctgcaggctggcgaagaacccctaccagaa
acggcgacggaggaagtgaagttcgttttcgacgaggcagttatgtcggagcttctgacc
atgggcttcccgccagaagcctgcaaacgggcctgcttccacacgaagaataccggcctg
gaggccgcctccaactggctgatggaacacatcgccgatgaggatatttcggaaccgttc
gtagtgcccaacaaccagattggtgactgtgccgcagagcagttcgtggccaatccggag
agcctggccatgctgatgagcatgggctttgatgagcgccaggcggtagctgctctaaag
gccaccgatgggaatgtggaacgcgccactgactggattttctcgcacgccgattccatt
ggcgtggaagaagtcgcacccgcccccgctgcgccagcctcgtcagccggaaatagtaag
accaactatagagatggcggcggaaagtacaagttggtggcatttatctcgcacatgggc
acctcctctcaggtgggccactatgtgtgccacattcgcaagcagggcgagtgggtcata
ttcaacgacagcaaggtggccaagtcgcagaacccgccaaaggacctcggctacctgtat
ctctacatgcgcgacgagtag

DBGET integrated database retrieval system