KEGG   Drosophila ananassae: Dana_GF10248Help
Entry
Dana_GF10248      CDS       T01059                                 

Definition
GF10248 gene product from transcript GF10248-RA
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dana_GF10248
Transcription machinery [BR:dan03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     Dana_GF10248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 696 aa AA seqDB search
MTKCSENASGDGQDFKKHETLKFQCLAKGEVVQDCVSDFVASQRCEGFIALSGSKMDVVT
LEMTSQAQPLNPFPYTPSYIELSASEPRPLDALAEKVDLEKVYTDCQILDAQELALETVY
TAVCSATVPSSLLKAVKKAPRLLPTGNYLLAVLNTHGSLTLLTKSVECTLWSRFESLNVP
LTLRDNLLPSVEADGISTFGQYKAMMDQAWITMFAWLGEESEGVENHSLVLGTANGGLWI
LKLSADAQTLEDHIYLETKLDRICFLHTFDNLLLVADVMGRVHLYRFTEWSNGGLTLVRS
LWERADRMGLQVGTISRSLEGNCYYITCCKAAHLLTWCLQGEDCLEARLHVGGIKITALC
SLDYQSYVVGTASQELKLIQVTHQGSQIHIKMQPVTVEDMSDFQVVGLATSRNKNLLTLL
LYPVKEYINAKKTEKNIVYVQVGQLHEHDVLARLTDSLNSDKPINVCLDYLAELRIKIFS
QKDLQGYSNFSPLDAFNFAEPATEAQLHQLQLKYHVLTTVGELQMAHLHLSTLIKKTQDE
TQLLLAMLATTHIRLRLQYLGSLDNLSGFQEQAANCMLAEAQRLCNGLQKDLTGEEHPLK
DTTRHFLHQIENHFQELRKKFAKISVTNPVEEQTALWCSISYVEIEPSLENRYCSLCSRQ
VLMQIQDLQQLFDPNLTPQLVCPFCHGSFTQELLTA
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaatgttctgaaaacgcttcaggcgatggccaagatttcaagaaacatgagacc
ctcaagttccagtgccttgccaagggagaggttgtacaggactgcgtgtcggattttgtt
gccagccaacggtgtgaaggtttcatagccctgtcgggttccaagatggatgtggtcact
ttggagatgacgtcccaagcccagcctctcaatccctttccctacacaccttcatacatc
gaattgtcggcctcggagccccggcctctggatgccctagccgagaaggtggatctggag
aaggtgtacaccgactgtcagatcctagatgcccaagagctggccttggaaacggtctat
acggcggtttgctccgcgactgttccatcatcccttttgaaggctgtgaaaaaagcgccg
cgtctactgcccactggtaactatctcctggcggtcctcaacactcatggatcgctaacg
ctgctgaccaagtcggtggaatgcacactatggagtcgcttcgaaagtctcaacgtgccc
ctcactctaagggacaatctcctgccgagtgtcgaggcagatgggataagtactttcggc
caatacaaagccatgatggaccaggcatggatcacaatgtttgcttggcttggcgaggaa
tcggagggggtggagaaccattccttggttctgggaactgccaatggaggcctgtggatc
ctcaagctctctgccgatgcccagacactagaagatcacatttatctcgaaaccaaactg
gatcgtatttgctttctgcatactttcgataatctgctgcttgtagccgatgtcatggga
agggtgcatctgtaccgcttcaccgaatggtccaatggcggactgaccctggtccgaagt
ctgtgggagagggcggatcgcatgggtctgcaagtgggtacgatttctcgaagcttggag
gggaactgctattacataacctgctgcaaggcagcgcatttgctgacctggtgccttcaa
ggagaggactgcttggaagcacgtctgcatgtcggcggaataaagatcacggcgttgtgc
agcctagactaccagagttatgtggtgggaacggcaagtcaggaactgaaactcattcaa
gtaacccaccagggtagccagatccacattaagatgcagccggtgaccgtggaagacatg
agtgacttccaggtggtgggactcgccactagcaggaacaagaatctgctgaccctgctc
ctctaccccgttaaggagtacataaatgcgaaaaaaactgaaaagaatattgtgtacgtt
caagtgggccaactccatgagcatgatgtcctagctcggctcaccgatagcctaaattcc
gacaaacccatcaatgtctgcctggactaccttgccgaacttcgcatcaagatattttcc
cagaaggacttacagggatactcgaattttagtccgttggatgcctttaatttcgcggag
ccggccacggaagcccagctgcatcaactgcaactgaaataccatgtcctgacgacggta
ggcgaactgcaaatggcccacctgcacctttccacgctcatcaaaaagacgcaggacgaa
acccaactgcttctggcaatgctggccaccacgcacataagacttcgactccagtatctg
ggttccctcgacaatctgtcaggatttcaggagcaagctgcgaactgcatgctggcggag
gcccagcgcctatgtaatggcctccaaaaagatttgacgggagaggagcatcctctcaag
gataccacaagacactttctgcatcaaatagagaatcactttcaagagctacgcaaaaag
tttgccaagatcagtgtaacaaatcctgtagaggagcagacagctctgtggtgttccatt
tcttatgtggagattgagcccagcttggagaatcgctactgcagcctgtgcagtcggcag
gtcctgatgcagatccaggacctgcagcagctgttcgaccccaacctgaccccccagctg
gtgtgtcctttctgccacgggagcttcacccaggaactgttaactgcataa

DBGET integrated database retrieval system