KEGG   Drosophila ananassae: Dana_GF10392Help
Entry
Dana_GF10392      CDS       T01059                                 

Definition
GF10392 gene product from transcript GF10392-RA
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dan  Drosophila ananassae
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:dan03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dan03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 497 aa AA seqDB search
MADTRTGRHAAAAGSSSSGISALTQSPANLECKDFQEYLRTRQTPETLEKLYNYPPICLA
VFRELPEIARQFIIRILFVDQPVPQAVVSSWGAQRCAKEQTDATSCLTALNVWRVTAIPG
GLSAWELSPTFKKSVRQVLLGGGKPWPMTNTLEKDSKPRDINFLDTYAMSRWRCVLHYMV
GTGSRNGAETEAISPDAVRILLHANLMKRDERDGITITRQGFQFLLLDTRAQVWHFMLHY
LDTCEERGMPLPECLSMLFQLSFSTLGRDYSSEGMNKQMLDFLQHLREFGLVYQRKRKEG
RFYPTRLALNVTSKEAAVAATLTTDEEGVQESGYIVVETNYRVYAYTDSPLQVAVLGLFT
ELLYRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRLVESAIQSKSCLPPT
VVDQIKLWEMERNRFTYTEGVVYNQFLSQNDFVTLRDYAQSIHVLVWQNERTRTMVVQKN
GHDDVKRYWKKYSKSGG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacgagaacaggtcggcatgccgctgctgcaggcagtagtagcagtggaatt
tcggcactgacgcagagcccggccaacttggagtgcaaggactttcaggaatatttgcga
acgcgtcaaacgccggaaacgctagaaaagttgtacaactatccgccgatctgcttggcc
gtgttccgggagctgcccgagatagccagacagtttattatacggattctgtttgtggac
cagcccgttccccaagcagtagtttcctcgtggggtgctcaacgatgcgcaaaagaacaa
acggacgccacaagttgcctgactgcattgaatgtgtggcgggtgactgccattccagga
gggctgtctgcctgggaactctcacccacattcaagaagagcgttcgccaggtgctgttg
ggcggcggaaagccctggcccatgaccaacaccctggagaaggactccaagccaagggat
attaactttttggatacgtacgccatgtcccgctggcgctgcgtgcttcactacatggta
ggtactggtagtcgaaatggtgccgaaacagaggctatcagcccagatgccgtcaggatc
ttgttgcacgcgaatcttatgaagagggatgaacgggatggaatcactataacccgccag
ggttttcagttcctgcttctggataccagggcgcaggtctggcactttatgcttcactat
ttggatacgtgcgaggagcgaggaatgcccctgccagaatgcctctccatgcttttccag
cttagcttctccacgctgggaagggactatagctccgagggcatgaacaaacagatgctg
gacttcctgcaacacctgagggagttcggtctagtctaccagcggaagcgtaaggagggc
cgcttctaccccacccgcctggctctcaatgtgaccagcaaggaagccgctgtggccgcc
accctaactacagatgaggagggagttcaggaaagtgggtacattgtggtggaaactaac
tatcgggtgtacgcctacacagactccccactccaggtggccgttttgggcctcttcaca
gagctactctaccgctttcccaatctcgtagtgggcgttctcacccgggactcggtgcgc
caggcgctacgcggcggaataacagccgaacaaatagtctcgtatctggaacagtacgcg
catcccaatatgcggctggtggaatcggccatccagtcgaagtcatgcctgccgccgacc
gtggtcgatcagataaagctgtgggaaatggagcgcaatcggttcacgtatacggagggc
gtggtgtacaatcagttcctgtcgcagaatgactttgtcacactccgggattatgcccaa
tcgatccacgtgctggtgtggcagaacgagcgcactcggacaatggtggtacaaaagaac
gggcacgacgacgtgaagaggtattggaagaagtactccaagagcggaggctag

DBGET integrated database retrieval system