KEGG   Drosophila ananassae: Dana_GF10532Help
Entry
Dana_GF10532      CDS       T01059                                 

Definition
GF10532 gene product from transcript GF10532-RA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dan  Drosophila ananassae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dana_GF10532
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dana_GF10532
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dana_GF10532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 240 aa AA seqDB search
MSIRQFQTISRQAFRCYSMRSLVDLGQAQLQRLPLRFCSVLLPVSCAASAVTASTPTSPC
SAAQYSTAAAIDMSNGDYKNAASIYEFTVKDTHGNDVSLDKYKGQVVLVVNIASKCGLTK
NNYQKLTDLKEKYGDKGLVILNFPCNQFGSQMPEADGEAMVCHLRDSKADIGEVFAKVDV
NGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNKEGIPVNRYAPTTDPMDIAKDIEKLL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcaggcagtttcagaccatttcccgacaggccttcaggtgctactcaatgcgt
tctctggtggacctgggccaggctcaattgcagcgcctgcccctccgcttttgctccgtt
ctgttgccagtcagttgtgcggccagtgccgtcacagcctccacacccacgtccccctgc
tcggcagcccagtactccacagcagccgccatcgacatgtctaacggagactacaagaac
gccgcctcgatctacgagttcaccgtaaaggacactcatggaaacgacgtgtcccttgac
aaatacaagggccaggtggttctggtggttaacatcgcctccaagtgcggcctgaccaag
aacaactaccagaagctgaccgacctgaaggagaagtacggtgacaagggcttggttatc
cttaacttcccctgcaaccagtttggatcccagatgccggaggctgatggcgaggccatg
gtctgtcacttgcgcgactccaaggccgatattggagaggtgttcgcaaaggtggacgtg
aatggcgataatgccgccccactctacaagtatctgaaggccaagcagacaggcactctg
ggcagcggtatcaagtggaacttcaccaagttcctggtcaacaaggagggcatccccgtc
aaccgctatgcccccaccaccgatcccatggacatagccaaggacatcgagaagctcctg
tag

DBGET integrated database retrieval system