KEGG   Drosophila ananassae: Dana_GF10570Help
Entry
Dana_GF10570      CDS       T01059                                 

Definition
GF10570 gene product from transcript GF10570-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dan  Drosophila ananassae
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dan00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 540 aa AA seqDB search
MASSPTSDSPSRPSIPITGPYVGAIDEGTTSARFIIFRAGTDDIVCYHQIEVPSIFAKEG
WCEQDPVGIANTVNECIAGACQKLVAAGGKVEEIVTIGITNQRESTVVWNRATGQPLANA
IIWLDNRTTSTVEELLETIPNNARNINYLRPLCGLPLSPYFSGVKLRWLRDNVPVVSQAM
DQGTAMFGTIDTWLMYCLTGGKDGGIHKTDVTNASRTMLMNIETLQWDTNLLKFFGLPST
ILPEICSSAEFYGNIANGVLKGVSITADLGDQQAALVGQQCLSKGQAKATYGTGCFLLYN
TGPSIVHSQHGLLTTVGYQLGRKAAPYYALEGSVSIAGAAFNWLRDNMGIIQNSGQIETM
ANLVDNSLDVYFVPAFNGLYAPYWNQDARGVICGLSEETTSEHIVRATLEAVCFQVRDIL
DSMHKDCKIPLAKLMVDGGMTVNNLFLQLQSDLVGIHVLRAKIAETTALGAAMAAYKAVE
SRYAMEAPLSKSGPREPIKPSINATERNLRYQKWKMAIERSLNWETSTLPHGEREAFDGA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatctccaacgtccgacagcccttcgcgtccatcaatcccgatcacaggcccg
tatgtgggtgccatcgacgagggcaccacctcggcccgattcataattttccgcgccggc
accgatgacattgtctgctatcaccagatcgaggtgccctcgatcttcgccaaggaggga
tggtgcgagcaggatcccgttggcattgccaacacggtcaacgagtgcattgccggagct
tgccagaaactggtcgccgcaggtggcaaagtggaggaaatcgttacaattggaataacc
aaccaacgcgagtccaccgtcgtatggaaccgggccacgggccagcctctggccaacgcc
atcatttggttggacaaccgcaccaccagcaccgtggaggagttgctggagacgatacct
aacaatgccagaaacatcaattacttgcgacctctctgcggactccccctttcgccgtac
ttctcaggcgtcaagctacgctggctgcgcgacaatgtcccagtagttagccaggcgatg
gaccagggcactgccatgtttggaaccatcgacacctggttgatgtactgcctaaccgga
ggaaaggacggaggcatacacaagacggatgtgaccaatgcatcgcgcaccatgttaatg
aacattgaaactctgcaatgggatacgaatctgctgaagttcttcgggttgcccagtacc
attctccccgagatctgttccagcgctgagttctatggcaacattgccaacggcgtgctc
aagggagtaagcatcactgccgatttgggcgatcagcaagcagctctagtgggccagcaa
tgtctgtccaagggacaggctaaggcaacctacggaacgggctgtttcctcttgtacaac
accgggccctctattgtccactcccagcacggacttctcaccacggtcggctaccaactg
ggcaggaaggctgccccgtactatgccctcgagggaagtgtttccattgctggagcggcc
tttaattggttgcgtgacaacatgggcatcatccagaactcggggcagattgagacaatg
gccaacttggttgacaactccctggacgtgtactttgtgccggcttttaatggactctac
gctccctactggaatcaggatgccaggggcgtcatctgcggactgagcgaggagactacc
agcgagcacattgtgcgagccaccttggaggcggtttgtttccaggtccgggacatcctt
gactcgatgcataaggattgcaagatcccgctagccaagctgatggtggacggtggcatg
actgtgaacaatcttttcctgcagcttcagtccgacttggtggggattcatgtgcttcgg
gctaagatagctgaaaccaccgctttgggcgctgccatggccgcatacaaagctgtggag
agtcgctatgcaatggaggctccactctcgaagtccggtcctcgggagcccatcaagccc
tctattaacgccaccgagcggaatctgcgttaccaaaagtggaaaatggccatcgagcgc
tccctaaactgggagacatccacgctgccacacggcgaacgagaagccttcgatggagca
tag

DBGET integrated database retrieval system