KEGG   Drosophila ananassae: Dana_GF10605Help
Entry
Dana_GF10605      CDS       T01059                                 

Definition
GF10605 gene product from transcript GF10605-RA
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dan  Drosophila ananassae
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dana_GF10605
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Dana_GF10605
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Dana_GF10605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 186 aa AA seqDB search
MVKIWFMDNEETDQRLEHHRNPPQYLELADLYRKTGVEYFKINADEYQSDKILSELRAKR
GYTYDDEITCSEKCLPDYANKLKAFFTEHLHTDEEIRLILEGTGYFDVRDDEENWLRIEV
IKGDLIIIPAGIYHRFSLDMNNFIRTRRYFVGEPVWTAHNRPADEMDCRKSYVKHQSEHF
VQFNKA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaatatggtttatggacaatgaagagacagaccagcgtctggagcaccaccgc
aatccaccacaatacctggagctggccgatctctaccggaaaaccggcgtggaatacttc
aaaatcaacgcggacgaataccagagtgataagattctttcggagctgcgggccaaacgg
ggttatacctacgatgatgagataacttgctcggaaaagtgcctgccggactatgccaac
aagctgaaggcgtttttcacggaacacttgcacaccgatgaagaaattcgccttatcttg
gaaggaactggatactttgatgtgcgcgatgacgaagaaaattggctgcgcatcgaggtc
attaagggagacctgattatcattcctgctggtatctaccatcgtttcagcctggatatg
aataactttatccgcactcgtcgttactttgtcggggagccggtctggaccgcccacaat
cgccccgccgatgaaatggattgccgcaaatcttatgtcaaacaccagtctgaacacttt
gtgcaatttaacaaggcttaa

DBGET integrated database retrieval system