KEGG   Drosophila ananassae: Dana_GF10608Help
Entry
Dana_GF10608      CDS       T01059                                 

Definition
GF10608 gene product from transcript GF10608-RA
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dan  Drosophila ananassae
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dan00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 235 aa AA seqDB search
MISFLYIVNRALSSTSIGSSPGITQSVLTSKMTAPGPRPLVLCGPSGSGKSTLLKRLFAE
YPNTFGFSISHTTRKPREGEEHGVHYYFVERPDMEAAIAGDEFIETAEFTGNLYGTSKAA
VREIQAKGRVCILDIEQKGVEQIRRTDLNPILIFNNPPTIKELERRLRLRGSETEESLNK
RLNAAQVEIDYGLTPGNFHKIINNVDIDVAYQEFRDFVVQELKKQESAGVTIALD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgataagctttttgtacattgtaaaccgcgcgctcagcagcacgagcatcggctccagt
cccggtataacccaatccgttttgaccagcaagatgaccgccccaggaccacgcccactc
gtcctctgcggaccgtctggctccgggaagagcactcttctgaaacgcctgttcgccgag
tatcccaacacctttggcttcagcatttcgcacacgacgcggaaaccacgcgagggcgag
gagcatggtgtccactactacttcgtggagcggccagatatggaggcagccatcgccgga
gatgagtttattgagacggccgaatttacgggcaatctgtatggaactagcaaggcggcc
gtgcgggagatccaggccaagggcagggtctgcattctcgacatcgagcagaagggcgtg
gaacagatccggcgcaccgacctcaaccccattctgatcttcaacaatccgcccaccatc
aaggagctggagcgaaggctgcggctacgtggctcggaaacagaggagtctctgaacaag
cgcctgaacgccgctcaggtggagatcgattatggactaacgcccggcaacttccacaag
atcatcaacaatgtggacatcgatgtggcctaccaggagttccgtgactttgtcgttcag
gagctgaagaagcaggagagtgctggagtgacaattgccctggattag

DBGET integrated database retrieval system