KEGG   Drosophila ananassae: Dana_GF10608Help
Entry
Dana_GF10608      CDS       T01059                                 

Definition
GF10608 gene product from transcript GF10608-RA
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dan  Drosophila ananassae
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dana_GF10608
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dana_GF10608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 235 aa AA seqDB search
MISFLYIVNRALSSTSIGSSPGITQSVLTSKMTAPGPRPLVLCGPSGSGKSTLLKRLFAE
YPNTFGFSISHTTRKPREGEEHGVHYYFVERPDMEAAIAGDEFIETAEFTGNLYGTSKAA
VREIQAKGRVCILDIEQKGVEQIRRTDLNPILIFNNPPTIKELERRLRLRGSETEESLNK
RLNAAQVEIDYGLTPGNFHKIINNVDIDVAYQEFRDFVVQELKKQESAGVTIALD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgataagctttttgtacattgtaaaccgcgcgctcagcagcacgagcatcggctccagt
cccggtataacccaatccgttttgaccagcaagatgaccgccccaggaccacgcccactc
gtcctctgcggaccgtctggctccgggaagagcactcttctgaaacgcctgttcgccgag
tatcccaacacctttggcttcagcatttcgcacacgacgcggaaaccacgcgagggcgag
gagcatggtgtccactactacttcgtggagcggccagatatggaggcagccatcgccgga
gatgagtttattgagacggccgaatttacgggcaatctgtatggaactagcaaggcggcc
gtgcgggagatccaggccaagggcagggtctgcattctcgacatcgagcagaagggcgtg
gaacagatccggcgcaccgacctcaaccccattctgatcttcaacaatccgcccaccatc
aaggagctggagcgaaggctgcggctacgtggctcggaaacagaggagtctctgaacaag
cgcctgaacgccgctcaggtggagatcgattatggactaacgcccggcaacttccacaag
atcatcaacaatgtggacatcgatgtggcctaccaggagttccgtgactttgtcgttcag
gagctgaagaagcaggagagtgctggagtgacaattgccctggattag

DBGET integrated database retrieval system