KEGG   Drosophila ananassae: Dana_GF10661Help
Entry
Dana_GF10661      CDS       T01059                                 

Definition
(RefSeq) GF10661 gene product from transcript GF10661-RB
  KO
K16061  
baculoviral IAP repeat-containing protein 7/8
Organism
dan  Drosophila ananassae
Pathway
Ubiquitin mediated proteolysis
Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dana_GF10661
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    Dana_GF10661
Ubiquitin system [BR:dan04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    Dana_GF10661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 444 aa AA seqDB search
MANVVTSSRYTYGPAAHEVTAPVFDQVDNNTNATQLFKNNIFNNIMNNFNREEDRLKSFI
NWPLDWLDKCQLAQTGMYYTNVDDKVKCYFCGVEIGRWEPEDQPVPEHQRWSPNCPLLRR
RTTNNVPLNGEALDRVLPPLSYDICGANDAATAGVELREHAYAEGRIPMSHMIQSIGVNT
ANGSVSVGPTLSSIATQASTATQANGDVQPETCRPPAASGNYFPEYPEYAVEAARLRTFE
AWPRNLKQKPPQLAEAGFFYTGVGDRVRCFSCGGGLKDWDDNDEPWEQHALWLSQCRFVK
LMKGQLYIDSLAAKPVAAEEKEDTPPVADSVSSSSSSTSTTETSEEASSGSGDVAPSTVA
STAARRIFDKIAESSSADVPPASSNSGSPSIPEEKMCKICYGAEYNTAFLPCGHVVACAK
CASSVTKCPLCRKPFTDVMRVYFS
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtggtaaccagctcgcggtatacttatggccccgccgcccacgaggtaaca
gcacctgtgttcgatcaggtggacaacaacacaaacgcaacccaactcttcaagaacaac
atcttcaacaacatcatgaacaacttcaatcgggaggaggaccgtttaaaatccttcatc
aactggcctctggactggctggacaaatgccagttggcccaaacgggcatgtactacacc
aacgtggacgacaaagtgaaatgctatttctgtggcgtagagatcggacgatgggagccc
gaggatcagcccgttccggagcatcaacgatggtccccaaactgcccgctactgcgtcgt
cgcaccaccaacaatgtaccgctcaacggcgaggcgctggatcgcgtcctgccacccctc
agctacgatatctgcggcgccaacgacgcagcgacagccggagtggagctccgcgaacat
gcctatgccgagggacgcatccccatgtcgcacatgatccagtcgatcggagtaaacacg
gcaaatggttcggtatccgtcgggccgactctcagctcgattgccacccaggcgtcgacg
gccacccaggccaacggcgatgtccagccggagacgtgccggccaccggctgccagtgga
aattattttcccgagtatccggaatatgccgtcgaagcggcacgcctgcgcaccttcgag
gcgtggccgaggaatctgaaacaaaagcccccccagctggccgaggcgggtttcttctac
acgggagtgggcgatcgcgttcgctgcttcagctgcggcggtggactgaaggactgggac
gacaacgacgagccctgggaacagcatgccctctggctgagtcagtgccggttcgtcaag
ctgatgaagggtcagttgtatatcgattctttggcagccaagccagtggcggccgaggag
aaggaggatactccaccagttgccgattcggtgagcagcagcagcagcagtacatccaca
accgaaacatccgaggaggcatcttccggatcgggagatgtggcaccatccaccgtagca
tcaacggccgcccgacgcatcttcgacaagatagcggagtcgtcgtccgccgacgttcca
cctgccagcagcaacagcggatcgccatcgatacccgaggagaagatgtgcaagatatgt
tacggcgccgagtacaatacggcttttttgccgtgcggccatgtggtggcgtgcgccaag
tgcgcctcatccgttaccaagtgcccactgtgccggaaaccctttaccgatgtgatgcgt
gtatatttttcttaa

DBGET integrated database retrieval system