KEGG   Drosophila ananassae: Dana_GF10661Help
Entry
Dana_GF10661      CDS       T01059                                 

Definition
GF10661 gene product from transcript GF10661-RA
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
dan  Drosophila ananassae
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dana_GF10661
Mitochondrial biogenesis [BR:dan03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    Dana_GF10661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 444 aa AA seqDB search
MANVVTSSRYTYGPAAHEVTAPVFDQVDNNTNATQLFKNNIFNNIMNNFNREEDRLKSFI
NWPLDWLDKCQLAQTGMYYTNVDDKVKCYFCGVEIGRWEPEDQPVPEHQRWSPNCPLLRR
RTTNNVPLNGEALDRVLPPLSYDICGANDAATAGVELREHAYAEGRIPMSHMIQSIGVNT
ANGSVSVGPTLSSIATQASTATQANGDVQPETCRPPAASGNYFPEYPEYAVEAARLRTFE
AWPRNLKQKPPQLAEAGFFYTGVGDRVRCFSCGGGLKDWDDNDEPWEQHALWLSQCRFVK
LMKGQLYIDSLAAKPVAAEEKEDTPPVADSVSSSSSSTSTTETSEEASSGSGDVAPSTVA
STAARRIFDKIAESSSADVPPASSNSGSPSIPEEKMCKICYGAEYNTAFLPCGHVVACAK
CASSVTKCPLCRKPFTDVMRVYFS
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtggtaaccagctcgcggtatacttatggccccgccgcccacgaggtaaca
gcacctgtgttcgatcaggtggacaacaacacaaacgcaacccaactcttcaagaacaac
atcttcaacaacatcatgaacaacttcaatcgggaggaggaccgtttaaaatccttcatc
aactggcctctggactggctggacaaatgccagttggcccaaacgggcatgtactacacc
aacgtggacgacaaagtgaaatgctatttctgtggcgtagagatcggacgatgggagccc
gaggatcagcccgttccggagcatcaacgatggtccccaaactgcccgctactgcgtcgt
cgcaccaccaacaatgtaccgctcaacggcgaggcgctggatcgcgtcctgccacccctc
agctacgatatctgcggcgccaacgacgcagcgacagccggagtggagctccgcgaacat
gcctatgccgagggacgcatccccatgtcgcacatgatccagtcgatcggagtaaacacg
gcaaatggttcggtatccgtcgggccgactctcagctcgattgccacccaggcgtcgacg
gccacccaggccaacggcgatgtccagccggagacgtgccggccaccggctgccagtgga
aattattttcccgagtatccggaatatgccgtcgaagcggcacgcctgcgcaccttcgag
gcgtggccgaggaatctgaaacaaaagcccccccagctggccgaggcgggtttcttctac
acgggagtgggcgatcgcgttcgctgcttcagctgcggcggtggactgaaggactgggac
gacaacgacgagccctgggaacagcatgccctctggctgagtcagtgccggttcgtcaag
ctgatgaagggtcagttgtatatcgattctttggcagccaagccagtggcggccgaggag
aaggaggatactccaccagttgccgattcggtgagcagcagcagcagcagtacatccaca
accgaaacatccgaggaggcatcttccggatcgggagatgtggcaccatccaccgtagca
tcaacggccgcccgacgcatcttcgacaagatagcggagtcgtcgtccgccgacgttcca
cctgccagcagcaacagcggatcgccatcgatacccgaggagaagatgtgcaagatatgt
tacggcgccgagtacaatacggcttttttgccgtgcggccatgtggtggcgtgcgccaag
tgcgcctcatccgttaccaagtgcccactgtgccggaaaccctttaccgatgtgatgcgt
gtatatttttcttaa

DBGET integrated database retrieval system