KEGG   Drosophila ananassae: Dana_GF10739Help
Entry
Dana_GF10739      CDS       T01059                                 

Definition
GF10739 gene product from transcript GF10739-RA
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dan  Drosophila ananassae
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dan04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 496 aa AA seqDB search
MKFLICTLLAAASFVAAVSGSEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCK
ALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQFQVRGYPTLKFFRSGAPVEYSGGR
QAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDAESEEAKTFTKAANGLD
SFVFGVSSNAEVIAKYEAKDNGVILFKPFDDKKSVFEGELSEENLKKFAQVQSLPLIVDF
NHESASKIFGGSIKSHLLFFVSKEAGHIEKYVDPLKEIAKQYRDDILFVTISADEEDHTR
IFEFFGMNKEEVPTIRLIKLEEDMAKYKPESNDLSAETIEAFLKKFLDGKLKQHLLSQEL
PEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDI
VIAKMDSTANELESIKISSFPTIKYFRKDDNKVIDYNLDRTLEDFVKFLDANGEVAEAEP
TEEAEEEEEAPKKDEL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctgatctgtacactgctcgcggcggcgtcctttgtggccgccgtctccggc
tcggaagtgaaagtggaggagggcgtcctggtcgcgactgtggacaacttcaagcaactg
attgccgacaacgagttcgtgctggttgaattctacgccccatggtgcggacactgcaag
gctctggctcccgaatacgccaaggccgcccaacagctggccgagaaggagtcgcccatc
aagctggccaaggtcgatgccaccgtcgagggtgagctggccgagcagttccaggtccgt
ggctaccccactctgaagttcttccgcagcggtgcccccgtggagtacagcggtggtcgt
caggccgccgacatcattgcctgggtgaccaagaagaccggacccccggccaaggatctg
accagcgttgccgatgccgagcagttcctcaaggacaacgagatcgccatcattggcttc
ttcaaggacgccgagtcggaggaggccaagaccttcaccaaggctgccaacggtctggac
tcgttcgtgttcggtgtgagcagcaatgctgaggtcatcgccaagtacgaggccaaggat
aatggcgtgatcctgttcaagcccttcgacgacaagaagtccgtgttcgagggtgagctc
agcgaggagaacctgaagaagttcgcccaggtgcagtccctgcccctgatcgttgacttc
aaccacgagtccgcttccaagatcttcggtggctccatcaagtcgcacctgctgttcttc
gtctccaaggaggccggacacattgagaagtacgtcgatcccctgaaggaaatcgccaag
cagtaccgcgatgacatcctgttcgtgaccatctccgccgatgaggaagaccacacccgc
atcttcgagttcttcggaatgaacaaggaggaggtccccaccattcgcctcatcaagctg
gaggaggacatggccaagtacaagcccgagtcgaacgatctgtctgctgagaccattgag
gccttcctgaagaagttcttggacggcaagctgaagcagcacctgctgtcccaggaactg
cccgaggactgggacaagaaccccgttaaggtgctggtttccagcaacttcgagagcgtt
gcccttgacaagagcaagtctgtgctggttgagttctacgccccatggtgcggacactgc
aagcagctggctcccatctacgaccagctggccgagaagtacaaggacaacgaggacatc
gtgattgccaagatggactccactgccaacgagctggagagcatcaagatctcttccttc
cccacgatcaagtacttccgcaaggatgacaacaaggtcatcgactacaacctggacagg
actctggaggacttcgtcaagttcttggatgccaacggtgaggtggccgaggctgagccc
accgaggaggctgaagaggaggaggaggcgcccaagaaggacgagttgtaa

DBGET integrated database retrieval system