KEGG   Drosophila ananassae: Dana_GF10786Help
Entry
Dana_GF10786      CDS       T01059                                 

Definition
GF10786 gene product from transcript GF10786-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dan  Drosophila ananassae
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dana_GF10786
   00053 Ascorbate and aldarate metabolism
    Dana_GF10786
   00500 Starch and sucrose metabolism
    Dana_GF10786
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dana_GF10786
   00860 Porphyrin and chlorophyll metabolism
    Dana_GF10786
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dana_GF10786
   00982 Drug metabolism - cytochrome P450
    Dana_GF10786
   00983 Drug metabolism - other enzymes
    Dana_GF10786
Enzymes [BR:dan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dana_GF10786
Glycosyltransferases [BR:dan01003]
 Others
  Hydrophobic molecule
   Dana_GF10786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 637 aa AA seqDB search
MRLLQIVSLLLCVVLASGANILAVLPSVWKSHYLFGRKLLQELVESPGNHSVTLISPHAA
QDGVDWEIPRIRELRIEGLRENWLDMGMSFEAEEMHAQSVMERFTRLIYAGTTNVDILLS
DSQVRKLLTSGERFDLLIVDLFLSDALLGLAFYYGIPTVAISPTDANSWLNNMFGNPQSS
SLDPSNFLPFTEKMNTRQRIVNSLMSTFERLTYNFFHLISQQSVYTNHFELLVKELPLYR
DLTKNLSLALINSHPGLHYSRAYLPNMVEVGGLHLTNANELILPKHLESFMKSSPSGVIY
FSLGADVQTAQLPLEKLSVIVDVFGHLKEFHFLLKWETEQFIPDLQLPENVLIADWFPQQ
AVLVHPQVKMFISSCGQLSVWESVVGRKPILAIPLLAEQEVMAKRLQHHGVSLTVGYDAI
TYDALLHGIRQLTLNSSYVEKMGQLNERLISRDSSPAAKAVRKIQLILDSGGADYLKSHA
NTLNFWRIEGIDVFLIIALGFCGILIVPFLAICCILRKSYHSQAAQSQPPYRTNLKVVGR
VHSYGEQGSRKSSASAEPLRRTRSAQSLSNRSSSSSMGSTSPTSLSTASTTPLDLTPPPP
VHLLGQVSPLQLYVNQQRIYSSEGKTSPEDNPERRFS
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcctgcagatagtttcgctgttgctctgcgttgtcctggcttcgggagccaat
atcctggcagtcctgcccagtgtctggaaatcccactatctctttggacgaaaactgctc
caggagctggtagagagtcccggcaaccactcggtgactctcattagtccacatgctgct
caggatggcgtggactgggaaatccctcggatcagggagctgcggatcgaggggctgagg
gaaaactggctggacatgggcatgagtttcgaggcggaggagatgcacgcgcagagtgtg
atggaacggttcaccaggctaatctacgccggcaccaccaacgtggacatccttctgtcc
gattcccaagtgaggaagctcctcaccagcggcgagagattcgatttgctcatcgtggac
ttgttcctaagtgatgctttgttaggattggccttttattatggtattcccaccgttgca
atcagccccaccgacgccaactcctggctcaataatatgtttggcaatccgcaatcttcg
tccctggatcccagcaactttttgccctttacggagaagatgaataccaggcagaggatt
gtaaactcgctgatgagtacctttgaacggttgacctacaattttttccacttgatttcc
cagcaatcagtttacacgaaccactttgagctactcgtgaaggagctaccgctctataga
gatctcaccaagaacttgagcctggccctaatcaattcccatccaggtctgcactattcg
cgagcttatttgccaaacatggtggaggtgggcggattgcatttgaccaatgccaatgaa
ctcatcttgccaaagcacctggaatcattcatgaaaagttcaccgagtggggtgatctac
tttagtttgggtgccgatgtccagacagctcagttgccgctggagaagctctcagttatt
gtggatgtttttgggcatctcaaggagtttcactttctattgaaatgggaaacagagcag
tttataccggatctgcagctgccggagaatgtgcttattgcggattggtttccgcagcag
gcggttttagtccatccacaggtgaagatgttcatcagcagctgtgggcagctgagtgtg
tgggaatcagtcgtgggacgaaagccaatacttgccattccccttttggccgagcaggag
gtgatggccaagagactgcaacaccatggagtctcgctaactgtgggctacgatgccata
acctacgacgctctgcttcacgggatcaggcagctcaccctgaacagcagctacgtggaa
aagatgggccaacttaacgagcggctgataagccgcgactcctcgccagccgccaaagca
gttcgaaagattcagctcattttggactctgggggagctgattaccttaaatcccatgcc
aatacgttgaatttttggagaatcgaaggcattgatgtttttctaattattgccctcggc
ttctgcggcattttgatagtgccatttttggccatttgttgcattctaaggaagtcctac
cacagccaagcggcgcagagtcagccgccgtatagaaccaaccttaaagtggtgggtaga
gttcatagctatggggagcaaggtagccgaaagtcttcagcttcagcggagcctctccgc
agaaccagatcggctcagtcgctatctaacaggtccagctcctcaagcatgggttccacc
tcgcccacaagcttatccacagcgtccaccactccactggatctgacaccaccgccgcca
gttcatctgcttggccaggtatcgccattgcagctgtacgtgaaccagcagcggatatac
tcaagcgaaggcaaaacatcaccagaggataacccagaacgaaggttctcctaa

DBGET integrated database retrieval system