KEGG   Drosophila ananassae: Dana_GF10813Help
Entry
Dana_GF10813      CDS       T01059                                 

Definition
GF10813 gene product from transcript GF10813-RA
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dana_GF10813
Peptidases [BR:dan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dana_GF10813
Transcription machinery [BR:dan03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dana_GF10813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 668 aa AA seqDB search
RSQSAKVAKIRRKQRKCDKAFVPSQPCTKRTKTKENSVDSNTSVLSSASSSSTYSSGSAV
VAGIGVGVGNNKRPGAGVGRGTAANETVASSAPTPTPATTTTTGALTSAAGRATKAKKEE
EQLTKGQSQKSPLNAADFSIVRSLRTVEKLATELDANVSATASSTADASSAVMSETGCRH
YQSYVKEHSYDTFRVIDAYFAACVNRDAREKKAIHCNCFECGSYGIQLYACLHCIYFGCR
GAHITSHLRAKKHNVALELSHGTLYCYACRDFIYDARSREYALINRKLEAKDLQKSLGWQ
PWIPTAKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTPLLSDYFMS
DRHDCGSKSSHKCLVCEVSRLFQEFYSGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEF
FIATLDVLHRHCVKAKAEHENKSNSSSSGSGTNSSSSSSSHCYGQCNCIIDQIFTGMLQS
DVVCQACNGVSTTFDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCS
TCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKKNA
YGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEGYLLFY
HKNVLEYE
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
cgcagccagagcgcaaaagtggccaaaattcggcgaaaacagcgcaagtgtgataaagcg
ttcgtgccatcgcagccgtgcacaaaacgaacgaaaacaaaagagaatagtgttgacagc
aatacgagcgttttgagcagtgccagcagcagcagcacctatagcagcggcagtgcagtc
gttgcgggcatcggcgtaggcgtaggcaacaacaagcgtccgggggcgggagtgggccgg
ggaacggccgcgaatgaaacggtagcttcttcagccccaacaccaacaccagcaacaaca
acaacaacaggagcactaacatcagctgccggccgcgcaacgaaagcgaaaaaggaagag
gagcagctaacaaagggtcaaagccaaaagagtcccctgaacgccgctgacttttcaatt
gttcggtccctgcgcaccgttgaaaagttagcgactgagctcgacgccaacgtcagcgcc
accgccagcagcacagccgacgccagcagcgctgtcatgtcagagacgggctgccggcat
tatcagagctacgtgaaggagcacagctatgatacattccgggtcatcgacgcctacttc
gcggcctgcgtcaacagagatgcgcgagagaagaaggccattcactgcaactgcttcgag
tgcgggagttatggcatccagttgtacgcctgcctgcactgcatctacttcggatgccgt
ggcgcccacatcaccagccacctgcgggcgaagaagcacaacgtggccctggagctctcg
cacggaacgctctactgctacgcgtgccgcgacttcatctacgatgcgaggagcagggag
tatgcgctaatcaaccggaagctggaggccaaggatctgcagaagagtctggggtggcag
ccatggattcctacagccaaggagacgaatctgctgttggccaacgcgcgccggaggttg
gtgagaccgaatcagacaatcggtctgagggggctcctaaatctgggggccacctgcttc
atgaactgcattgtccaggccctggttcacactccgctgctcagtgactactttatgtcg
gatcgccatgattgcggtagtaagtcctcgcacaaatgtctcgtctgcgaagtttcgcgt
ctcttccaggagttctattcgggctcccgttcgccgctgtccctgcaccggctactgcat
ttaatctggaaccatgcgaagcacctggccgggtatgagcaacaggatgcccatgagttc
tttattgccactctggacgtgctgcatcgtcactgcgtcaaggcgaaggccgagcacgag
aacaagagcaacagctccagctccggcagcggcaccaattccagcagctcgagcagctcc
cattgctatggacagtgcaactgcatcatcgaccagatcttcaccggcatgctgcagagc
gatgtggtgtgccaggcctgcaacggtgtctccaccacctttgatcccttctgggacata
tcgctggacctgggggagacgacaacgcatggtggagtcactcccaagacgctgatcgac
tgcctggagcggtatacgcgggccgaacacctaggatcggcggccaagatcaagtgctcc
acctgcaagtcctaccaggagtccaccaagcagttcagccttcgcaccctgcccagtgtc
gtctcttttcatctcaaacgtttcgagcactcggccctcatcgaccgcaagatctcctcg
ttcatccagttcccggtggagttcgacatgacgccgtttatgtccgagaagaagaatgcc
tacggagacttccggttctccttgtacgccgtggtcaaccatgtgggcaccatcgacact
ggacactatacggcgtatgtgcgccaccagaaggacacttgggtgaagtgcgatgatcat
gtgataacgatggcgtcgctcaagcaggtgctagacagcgagggttatttattgttctac
cataaaaacgtgctggagtacgagtga

DBGET integrated database retrieval system