KEGG   Drosophila ananassae: Dana_GF10813Help
Entry
Dana_GF10813      CDS       T01059                                 

Definition
(RefSeq) GF10813 gene product from transcript GF10813-RB (EC:3.4.19.12)
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dana_GF10813
Peptidases [BR:dan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dana_GF10813
Transcription machinery [BR:dan03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dana_GF10813
Ubiquitin system [BR:dan04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dana_GF10813
Chromosome [BR:dan03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     Dana_GF10813
    SLIK complex
     Dana_GF10813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 721 aa AA seqDB search
MRLGTLSPYSHEFKKSENRPSSYLISFRSQSAKVAKIRRKQRKCDKAFVPSQPCTKRTKT
KENSVDSNTSVLSSASSSSTYSSGSAVVAGIGVGVGNNKRPGAGVGRGTAANETVASSAP
TPTPATTTTTGALTSAAGRCAAFFGEAVARGGRGGGAGVGGAGESATKAKKEEEQLTKGQ
SQKSPLNAADFSIVRSLRTVEKLATELDANVSATASSTADASSAVMSETGCRHYQSYVKE
HSYDTFRVIDAYFAACVNRDAREKKAIHCNCFECGSYGIQLYACLHCIYFGCRGAHITSH
LRAKKHNVALELSHGTLYCYACRDFIYDARSREYALINRKLEAKDLQKSLGWQPWIPTAK
ETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGS
KSSHKCLVCEVSRLFQEFYSGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDV
LHRHCVKAKAEHENKSNSSSSGSGTNSSSSSSSHCYGQCNCIIDQIFTGMLQSDVVCQAC
NGVSTTFDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQE
STKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKKNAYGDFRFS
LYAVVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEGYLLFYHKNVLEY
E
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgggcacactgtcaccgtactctcacgagttcaaaaaaagcgaaaaccggccg
agttcctatttaatatcatttcgcagccagagcgcaaaagtggccaaaattcggcgaaaa
cagcgcaagtgtgataaagcgttcgtgccatcgcagccgtgcacaaaacgaacgaaaaca
aaagagaatagtgttgacagcaatacgagcgttttgagcagtgccagcagcagcagcacc
tatagcagcggcagtgcagtcgttgcgggcatcggcgtaggcgtaggcaacaacaagcgt
ccgggggcgggagtgggccggggaacggccgcgaatgaaacggtagcttcttcagcccca
acaccaacaccagcaacaacaacaacaacaggagcactaacatcagctgccggccggtgt
gcggcatttttcggcgaagctgttgcaagaggtgggcgtggcggcggggccggcgttggg
ggtgccggagaaagcgcaacgaaagcgaaaaaggaagaggagcagctaacaaagggtcaa
agccaaaagagtcccctgaacgccgctgacttttcaattgttcggtccctgcgcaccgtt
gaaaagttagcgactgagctcgacgccaacgtcagcgccaccgccagcagcacagccgac
gccagcagcgctgtcatgtcagagacgggctgccggcattatcagagctacgtgaaggag
cacagctatgatacattccgggtcatcgacgcctacttcgcggcctgcgtcaacagagat
gcgcgagagaagaaggccattcactgcaactgcttcgagtgcgggagttatggcatccag
ttgtacgcctgcctgcactgcatctacttcggatgccgtggcgcccacatcaccagccac
ctgcgggcgaagaagcacaacgtggccctggagctctcgcacggaacgctctactgctac
gcgtgccgcgacttcatctacgatgcgaggagcagggagtatgcgctaatcaaccggaag
ctggaggccaaggatctgcagaagagtctggggtggcagccatggattcctacagccaag
gagacgaatctgctgttggccaacgcgcgccggaggttggtgagaccgaatcagacaatc
ggtctgagggggctcctaaatctgggggccacctgcttcatgaactgcattgtccaggcc
ctggttcacactccgctgctcagtgactactttatgtcggatcgccatgattgcggtagt
aagtcctcgcacaaatgtctcgtctgcgaagtttcgcgtctcttccaggagttctattcg
ggctcccgttcgccgctgtccctgcaccggctactgcatttaatctggaaccatgcgaag
cacctggccgggtatgagcaacaggatgcccatgagttctttattgccactctggacgtg
ctgcatcgtcactgcgtcaaggcgaaggccgagcacgagaacaagagcaacagctccagc
tccggcagcggcaccaattccagcagctcgagcagctcccattgctatggacagtgcaac
tgcatcatcgaccagatcttcaccggcatgctgcagagcgatgtggtgtgccaggcctgc
aacggtgtctccaccacctttgatcccttctgggacatatcgctggacctgggggagacg
acaacgcatggtggagtcactcccaagacgctgatcgactgcctggagcggtatacgcgg
gccgaacacctaggatcggcggccaagatcaagtgctccacctgcaagtcctaccaggag
tccaccaagcagttcagccttcgcaccctgcccagtgtcgtctcttttcatctcaaacgt
ttcgagcactcggccctcatcgaccgcaagatctcctcgttcatccagttcccggtggag
ttcgacatgacgccgtttatgtccgagaagaagaatgcctacggagacttccggttctcc
ttgtacgccgtggtcaaccatgtgggcaccatcgacactggacactatacggcgtatgtg
cgccaccagaaggacacttgggtgaagtgcgatgatcatgtgataacgatggcgtcgctc
aagcaggtgctagacagcgagggttatttattgttctaccataaaaacgtgctggagtac
gagtga

DBGET integrated database retrieval system