KEGG   Drosophila ananassae: Dana_GF10894Help
Entry
Dana_GF10894      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03259  translation initiation factor 4E
Organism
dan  Drosophila ananassae
Pathway
dan03013  RNA transport
dan04150  mTOR signaling pathway
Module
dan_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dana_GF10894
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dana_GF10894
Messenger RNA biogenesis [BR:dan03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dana_GF10894
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dana_GF10894
Translation factors [BR:dan03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dana_GF10894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 6493761
NCBI-ProteinID: XP_001958385
FlyBase: FBgn0087934
UniProt: B3M9H8
Position
Unknown
AA seq 230 aa AA seqDB search
MLTAKQTELKMMDCETETLPESRSSSGQELKALSEMADLRKPLKEIVDLRFKHPLEHTWT
LWYLENDRSKSWEDMQNEITSFDMVEDFWSLYNHIKPPSEIKIGSDYSLFKKGIQPMWED
DANKFGGRWVINMGRGSKLELDKLWLDVLLILIGEAFEHTEEVCGAVINLRGKSNKISIW
TANGHNELAVMEIGVKLRDLLALPPHQLQYQLHKDSMSKQGSVVKAVYCV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgctcacggccaagcagaccgaactaaagatgatggactgcgagacggagacgctgccg
gaatcccgttctagttccggccaggagctgaaggccctgtcggaaatggccgacctgcgc
aagccgctcaaggagattgtcgacttgcgcttcaagcatccactggagcacacgtggacg
ctctggtatctggagaacgatcgcagcaagtcttgggaggatatgcagaacgagatcacc
agcttcgacatggtcgaggatttctggagcctttacaaccacatcaagccaccgtctgag
atcaagataggcagcgattactcattgttcaagaagggcatacaaccaatgtgggaggat
gatgccaacaagttcggcggtcgctgggtcatcaatatggggcgtggctccaaactggag
ctcgacaagctttggctggatgtgctactcatactgattggcgaggcctttgagcacact
gaagaagtctgcggcgctgttatcaacttgcgtggcaagagcaacaaaatttcaatttgg
accgccaacgggcacaacgagctggccgtcatggagattggagtgaagctgcgcgacctg
ctcgcccttccgccccaccaactgcagtaccagctgcacaaggactctatgtccaagcag
ggatcggtggtcaaagcggtttactgcgtgtaa

DBGET integrated database retrieval system