KEGG   Drosophila ananassae: Dana_GF10927Help
Entry
Dana_GF10927      CDS       T01059                                 

Definition
GF10927 gene product from transcript GF10927-RA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dan  Drosophila ananassae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dana_GF10927
   00052 Galactose metabolism
    Dana_GF10927
Enzymes [BR:dan01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dana_GF10927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 364 aa AA seqDB search
MVNVKEDVFATGAVNPFTKASEDIKRFTLTNGFGMSVQLITRGATITSIKTPDSSGKVDD
VTLGFDDLAGYQSDKNPYFGATIGRVCNRIANGRFQLDGKWIEVSKNRNNKFQLHGGFVG
FDKAHWEVVAVRPDGVTLSHTNPDGHEGYPGKVTATASFTLSEDNCLHVLMTAETDKITP
VNLTNHSYFNLAGHKTGANGLYEHAIEINAYGITETDQDSIPTGKITPVDSTNYDLRVAG
NLGERLKALQPARGYDDNFCVTFSPPQPLAMVARASHPPSGRWLEVVSNQPGVQFYTSNF
MPDVENGETPIAGKDGASYGKHGAFCLETQKFPDSVNHSNFPTTILRPGERYNHEVIYKF
GVFN
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacgtcaaagaggatgttttcgccaccggagcggtgaacccgttcaccaaggcc
tcagaggacatcaagcgattcaccctgaccaatggctttggaatgtctgtccagctgatt
acccgtggagctactataaccagcattaagacaccggactccagcggaaaagtagatgac
gtgactctgggatttgatgatctggccgggtatcagagcgataagaatccctatttcgga
gccactattggacgtgtgtgcaatcgaattgcaaacggaagatttcagctggacgggaag
tggatagaggtgtccaagaacaggaacaacaagttccaacttcatggcggctttgtgggt
ttcgataaggcccactgggaagtggtggctgtgcgaccagatggcgtcaccctatcacac
accaatccagacggacatgagggctatcccgggaaggtgacagccacggccagtttcacc
ctgagcgaggataactgtcttcatgtcctgatgactgcagaaaccgacaaaatcacgccc
gtgaatctgaccaatcattcgtatttcaacctggcggggcacaaaactggagccaatggt
ctttatgagcacgctatcgaaataaacgcatatggcatcactgaaactgatcaggactcc
atacccactggaaagataacacccgtggatagcaccaactacgatctccgtgtagcgggc
aatctgggggaacgtctcaaggctctgcagcccgcgcgaggatatgatgacaacttctgc
gtgacttttagtccgcctcaaccgttggccatggtggccagggcctcgcatccacccagt
ggccgctggctggaggtggtgagcaatcagcctggggtacagttctatacctcaaacttt
atgcccgacgtggagaacggagaaacgccaattgctggaaaggacggagcctcctacgga
aaacacggagccttctgcctggaaactcagaagtttccggactctgtgaaccacagtaac
ttccccacaaccattttgcgaccgggcgagcgctacaaccatgaagtcatctacaagttc
ggcgtcttcaactga

DBGET integrated database retrieval system