KEGG   Drosophila ananassae: Dana_GF10939Help
Entry
Dana_GF10939      CDS       T01059                                 

Definition
GF10939 gene product from transcript GF10939-RA
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
dan  Drosophila ananassae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dan01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dan00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 776 aa AA seqDB search
MLRNSFSLAQSLRNSFSSNAWRAVSSHGPRQPLVSPERRLEKAHPTFTERSQLKYARRLV
VKLGSAVITREDNHGLALGRLASIVEQVAECHLEGREVMMVTSGAVAFGKQKLAQELLMS
LSMRETLNPKDSKEFDGATLEPRAAAAVGQSGLMSLYDAMFAQYGVKIAQVLVTKPDFYN
EETRNNLFCTLSELISLNIVPIINTNDAVSPPMFIRDDEPAGGARRGIPIKDNDSLSAML
AAEVQADLLILMSDVDGIYNKPPWEDGAKLMHTYTSDDSNSIEFGKKSKVGTGGMDSKVK
AATWALDRGVSVVICNGMQEKAIKTIIGGRKVGTFFTEATESSNAVPVEVMAENARTGSR
QMQALTPAQRASAVNTLADLLVSREKFILEANAKDLAEAQKNGLAKPLLSRLSLNSAKLK
NLSIGLKQIAEDSHKNVGRVLRRTRLADHLELKQVTVPIGVLLVIFESRPDSLPQVAALA
MASANGLLLKGGKEAAHSNKALMELVKEALATVGADHAVSLVSTREEISDLLSMENHIDL
IIPRGSSELVRNIQQQSLHIPVLGHAEGVCHVYIDRDADLQKALHIARDAKCDYPAACNA
METLLIHEDLMSGEIFTDVCNMLKREGVKIYAGPRLNQQLTFGPPAAKSLKHEYGALECC
IEIVPSLEEAINHIHTYGSGHTDVIVTENDAAAKQFLGSVDSACVFHNASSRFADGFRFG
LGAEVGISTARIHARGPVGVEGLLTTKWILNGEDHAAADFAEGGRRTWLHETLPLD
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcaacagctttagcctggcccagagcctgcgcaacagcttctccagcaacgcc
tggcgagcggtcagctcgcacggacccaggcagccactggtgtcccccgaacggcgtctg
gagaaggcccatcccaccttcacggagcgcagccagctcaagtatgcccgcaggctggtg
gtcaagctgggcagtgccgtcatcacccgggaggataatcatggattggcccttggccgt
ctggcttctattgtggaacaggttgccgagtgtcacctggagggacgtgaggtgatgatg
gtgaccagtggagcggtagcctttggaaaacagaagcttgcccaggagctgctcatgtcg
ctgtcgatgcgagagaccctcaacccgaaggacagcaaagagtttgacggcgccactctg
gaaccacgagcggcggctgcggtgggtcagtcgggtctgatgtcgctctacgatgcaatg
ttcgcccagtacggcgtcaagatagcacaggtgctggtgaccaagccggacttctacaac
gaggagacacgcaacaatctcttctgcacgctctccgaattaattagcctgaatattgtg
cccatcataaataccaacgacgccgtttccccgccgatgttcatacgtgacgacgagcca
gccggcggggccaggcggggcattcctattaaggacaacgacagcttatcggccatgctg
gctgccgaggttcaggccgacctgctaatcctcatgtcggatgtcgatggcatctacaat
aagccgccctgggaggatggcgccaagctgatgcacacctacaccagcgacgacagcaac
agcatcgagtttggcaaaaagtcaaaggtgggcactggcggcatggactcaaaggtgaag
gcggccacctgggcactggaccggggcgttagtgtggtcatctgcaacggcatgcaggag
aaggccatcaagaccataattggcggccggaaggttggcaccttcttcacggaggcgacc
gagagctccaacgccgttcccgtcgaggtgatggccgagaacgcacgtaccggaagccgc
cagatgcaggctctgacccccgcacagcgggccagtgccgtgaacaccctggccgacctg
ctggtgagtcgcgagaagttcatcctggaggccaacgccaaggacctggccgaggcccag
aagaacggactggccaagccactgctttcgcggctctccctcaactccgccaagctgaag
aacctctccattggccttaagcaaatcgccgaggacagtcacaagaatgtgggtcgtgtc
ctccgacgcacccggcttgccgatcatctcgagctgaagcaggtcaccgtccccatcggc
gttctactggtcatcttcgaatcccgccccgactccctgccccaggtggccgccctggcg
atggcctcggccaacggcctgctgctcaagggcggcaaggaggcggcccacagcaacaag
gccctcatggaactggtcaaggaggcactggccaccgtgggcgccgaccacgccgtatcc
ttggtttccacgcgagaggagatcagcgacctgttgtccatggaaaaccacatcgacctg
atcattcctcgcggctcctccgagctggtccgcaacatccagcagcagtcgctacacatc
ccagtcctgggccatgccgagggcgtctgccacgtgtacatcgaccgggatgcggatctg
cagaaggcgctgcacatcgctcgggacgccaagtgcgactatccggcggcctgcaacgcc
atggagacccttctgattcatgaggatctgatgagtggcgaaatcttcaccgacgtctgc
aatatgctgaaacgtgagggcgtcaaaatctacgccgggccccgtctaaaccagcagctg
acctttggccctccggcggccaagagcctgaagcacgagtacggagccctcgagtgctgc
atcgagattgtgcccagcctggaggaggccattaatcacatccatacgtacggcagtggc
cacaccgatgtcattgttacggaaaatgatgcggcggccaagcagttcctggggagcgtg
gacagcgcctgtgtgttccacaacgcgagctcccggttcgcggacggcttccggttcggc
cttggcgccgaggtgggcatctcgaccgcccgcatccacgcccgcggaccggtgggcgtg
gagggcctgctgaccaccaagtggatactgaacggagaggaccacgccgccgccgacttc
gccgagggcgggcgtcgcacgtggctgcacgagaccctgcccctggactag

DBGET integrated database retrieval system