KEGG   Drosophila ananassae: Dana_GF11191Help
Entry
Dana_GF11191      CDS       T01059                                 

Definition
GF11191 gene product from transcript GF11191-RA
Orthology
K04646  
clathrin heavy chain
Organism
dan  Drosophila ananassae
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:dan00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dana_GF11191
   04142 Lysosome
    Dana_GF11191
Exosome [BR:dan04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dana_GF11191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1679 aa AA seqDB search
MAQPLPIRFQEHLQLTNVGINANSFSFSTLTMESDKFICVREKVNDTAQVVIIDMNDATN
PTRRPISADSAIMNPASKVIALKAQKTLQIFNIEMKSKMKAHTMSEDVVFWKWISLNTLA
LVTETSVFHWSMEGDSMPQKMFDRHSSLNGCQIINYRCNATQQWLLLVGISALPSRVAGA
MQLYSVERKVSQAIEGHAASFATFKIDGNKEPTTLFCFAVRTATGGKLHIIEVGTPPNGN
QAFPKKAVDVFFPPEAQNDFPVAMQVSVKYDTIYLITKYGYIHLYDMETATCIYMNRISA
DTIFVTAPHESSGGIIGVNRKGQVLSVTVDEEQIIPYINTVLQNPDLALRMAVRNNLAGA
EELFVRKFNKLFTAGQYAEAAKVAALAPKAILRTPQTIQRFQQVQTPAGSTTPPLLQYFG
ILLDQGKLNKFESLELCRPVLLQGKKQLCEKWLKEEKLECSEELGDLVKASDLTLALSIY
LRANVPNKVIQCFAETGQFQKIVLYAKKVNFTPDYIYLLRSVMRSNPEQGAGFATMLVAE
EEPLADISQIVDIFMEHSMVQQCTAFLLDALKHNRASEGALQTRLLEMNLMSAPQVADAI
LGNAMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHMLNAEWLVSFFGTLS
VEDSIECLKAMLTANLRQNLQICVQIATKYHEQLTTKALIDLFESFKSYDGLFYFLSSIV
NFSQDPEVHFKYIQAACKTNQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCD
RFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQ
FSTDELVEEVEKRNRLKLLLTWLESRVHEGCVEAATHNALAKIYIDSNNNPERFLKENQY
YDSRVVGRYCEKRDPHLACVAYERGHCDRELIAVCNENSLFKSEARYLVGRRDAELWAEV
LSESNPYKRPLIDQVVQTALSETQDPDDISVTVKAFMTADLPNELIELLEKIILDSSVFS
DHRNLQNLLILTAIKADRTRVMDYINRLDNYDAPDIANIAISNQLYEEAFAIFKKFDVNT
SAIQVLIDQVNNLERANEFAERCNEAAVWSQLAKAQLQQGLVKESIDSYIKADDPSAYVD
VVDVASKVESWDDLVRYLQMARKKARESYIESELIYAYARTGRLADLEEFISGPNHADIQ
KIGDRCFNDGMYDAAKLLYNNVSNFARLAITLVYLKEFQGAVDSARKANSTRTWKEVCFA
CVNAEEFRLAQMCGLHIVVHADELEDLINYYQNRGYFDELIALLESALGLERAHMGMFTE
LAILYSKFKPSKMREHLELFWSRVNIPKVLRAAESAHLWSELVFLYDKYEEYDNAVLAMM
AHPTEAWREGHFKDIITKVANIELYYKAIEFYLEYKPLLLNDILLVLAPRMDHTRAVSYF
SKTGYLPLVKPYLRSVQSLNNKAINEALNGLLIDEEDYQGLRNSIDGFDNFDNIALAQKL
EKHELTEFRRIAAYLYKGNNRWKQSVELCKKDKLYKDAMEYASESGKQELAEELLGWFLE
RDAHDCFAACLYQCYELLRPDIILELAWKHKILDFAMPYLIQVLREYTIKVDKLELSEAQ
REKDNDSTEQKNIIQMEPQLMITAGPALGISSQYPQNYPSGATPISAAVTGRNLGYPYL
NT seq 5040 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaccgctcccgatacgttttcaggagcatttgcaacttacaaatgttgggatc
aatgcaaactcattttcgttcagcactcttacgatggaatcggataagtttatatgtgtt
cgagagaaagtaaatgatactgcccaagtggttataatcgatatgaatgatgctactaat
cccactcgtcgaccgatatcagcggactctgcaattatgaatccggcaagcaaggtcatt
gcccttaaagcacaaaaaacattgcagatttttaatattgaaatgaaatctaaaatgaaa
gcgcatacaatgagtgaagatgtggtgttttggaaatggatatcgctgaatactttagcg
cttgttacggaaacgagcgtatttcattggtcaatggaaggtgattcaatgccacaaaaa
atgtttgacagacattcttctcttaatggatgccaaataattaattaccggtgcaacgct
acgcaacaatggcttcttttggtgggaatatccgcgctgcccagccgagttgctggtgct
atgcagttatattcggtagaacgcaaggtttcacaagccattgaaggtcacgctgctagt
tttgccacttttaaaattgatggtaataaagagccaacaacgttgttttgttttgctgtg
cgtactgctactggcggcaagcttcatattatcgaagtaggaactccgccaaatggtaac
caggcttttcctaagaaagctgtagatgtgttctttccgccagaagcgcaaaatgatttc
ccagtcgctatgcaagtttcggtcaagtatgatacaatatatttgataacgaaatatgga
tacattcatctttacgatatggaaacagctacatgtatttacatgaatcgcatatctgcg
gatacgatttttgtaactgcaccacacgaatccagtggaggtataattggcgttaatcgt
aaaggacaagtgttatctgtgactgtggatgaggaacaaataattccgtacattaatacg
gtgttgcaaaatcctgacttagcgctacgcatggctgttcgtaataatttggccggtgcc
gaagaactttttgtacgcaagtttaataagctatttacagcaggtcaatatgctgaagct
gcaaaagtagctgctctagcacccaaagccattttacgtactccacaaaccattcaacgg
tttcagcaagttcaaacaccagcaggatcgacaacacctccattactgcaatattttgga
attcttttggaccagggaaaattaaataagtttgaatctctagagctgtgtcgtccagtt
ctattgcaaggaaagaagcaattgtgcgaaaagtggcttaaagaagaaaaattagagtgc
agcgaggagctaggtgatctcgtaaaggcttccgatcttactctggctctttccatatac
ttgcgtgcaaatgttcccaacaaggtcattcaatgttttgctgaaactggacagttccaa
aagattgtactatacgctaaaaaagtaaacttcacgcctgattatatttatctgttgcga
tcggtaatgcgaagcaatcccgaacaaggggctggctttgccaccatgcttgtggcagaa
gaagagcctttggcggatatcagccagattgtggatatatttatggaacattctatggtg
cagcagtgtacagcgtttcttttagacgctcttaaacataatcgagcttcagaaggtgcc
cttcagacgcgtttacttgaaatgaaccttatgtctgcgccccaagtggctgatgctatt
ttgggtaacgccatgtttactcattacgatcgtgcccatattgcccaattgtgtgagaaa
gcaggattactgcaacgtgctcttgagcattacacagatctttatgatatcaaaagggcc
gttgtgcatactcacatgctaaatgccgaatggttggtcagtttctttggcactttatct
gtagaggactccatagaatgtctaaaagcgatgcttacagccaatttacgccagaacctc
caaatttgcgttcagattgcaaccaaataccatgaacaacttacaactaaagctcttatt
gatcttttcgaaagctttaaaagctacgacggtttattctactttctaagcagcattgtg
aatttttcgcaagaccctgaggttcactttaaatacattcaggctgcatgtaaaactaat
caaattaaggaagtagagcgtatttgtcgagaatcaaattgctacaatcctgaacgggtc
aaaaatttcctaaaagaagcaaaacttactgatcaacttcctttaattattgtttgtgat
cgatttgacttcgttcacgatttggtactttacttataccgtaataatcttcaaaaatat
attgaaatatatgtgcaaaaagttaatccttctcgtttaccagttgtagtgggtggactt
cttgatgttgactgcagcgaagatatcattaaaaatcttatcttagttgtaaaaggacaa
ttctctacagatgaacttgtggaagaagttgaaaaacgcaatcggctaaaacttcttttg
acgtggttagaatcacgtgttcatgaaggttgcgttgaggccgccacgcacaacgcattg
gccaagatttacattgattcaaataacaatccagagcgatttcttaaggaaaatcaatac
tacgacagtcgtgtggtgggtcggtattgcgagaaacgcgatccccacttggcttgtgtc
gcgtatgaacggggtcattgtgaccgcgaactgatagcagtttgtaacgaaaattctcta
tttaaaagtgaagccaggtatttagttggacgacgagatgccgaactgtgggcagaagtg
ctttcagaatcaaatccctataaacgtccgttgattgatcaagttgtgcagacggctttg
tctgaaactcaagaccccgatgatatttcggtgacagtcaaagcatttatgactgctgat
ttacctaatgaacttatagaacttcttgaaaagattattttggactcctcagtgtttagt
gaccatcgtaatctacaaaatttgcttattcttacagcaatcaaagcagatcgtacgcgt
gtcatggattatataaatcgtttggataactatgatgccccagacattgcaaacattgca
attagtaaccaattgtacgaagaagcttttgctatttttaagaagtttgacgtaaacact
tccgctattcaggtactcattgatcaagtaaacaacttggagagggcaaacgaatttgct
gaacgttgtaacgaagcagcagtgtggtcccaattggctaaagctcagctgcaacaaggg
ctggtaaaagagtctattgattcatatattaaagccgatgatccgagtgcatatgtcgat
gtagttgacgtagccagtaaagtggaatcatgggacgaccttgttcgctacttacaaatg
gcgcgtaaaaaggcacgtgaatcttatatcgaaagtgaattaatatatgcatatgcgcga
acaggaaggctagccgatctcgaggagtttatatcaggccctaatcacgcagacattcaa
aaaattggtgaccgttgttttaatgatggaatgtatgatgctgcaaaactgctttataat
aacgtcagcaactttgcacggttagcaattacgctagtatatcttaaggagtttcaaggg
gccgtcgattctgctcgaaaagcaaactctactcgaacctggaaagaagtatgttttgct
tgtgtgaatgcagaggaatttcggctagcccaaatgtgtgggttacacatagtcgtccac
gcggatgagcttgaggatttaataaattattatcagaatcgaggatatttcgatgaattg
atagcgttactcgaatctgccctggggttagaacgtgctcacatgggaatgtttacagag
cttgctatattgtattccaaattcaaaccctcaaaaatgagagaacatttggaactgttt
tggtcacgcgttaatataccaaaagttctgagggctgcagaatcagctcatttgtggtct
gaattagtttttctttatgataaatacgaagagtatgacaatgctgttttagctatgatg
gctcatcccactgaggcttggcgtgaaggtcattttaaggacattatcactaaagtggca
aatattgagttgtactacaaagccattgaattttatcttgaatataagccattgttgttg
aatgatatccttcttgtactggcacctagaatggatcatacccgtgctgttagttacttt
tcaaaaactgggtatctcccacttgtgaagccttatttacgctctgttcaatctcttaat
aataaggcaattaacgaagctcttaatggacttttaattgacgaggaagactaccaagga
ttaaggaattcaatcgatggctttgacaattttgataatattgcactggctcaaaagctt
gaaaagcatgaactaactgaattcagacgaatagctgcatacttatacaagggaaataat
cgatggaaacaaagcgttgaactttgtaagaaggacaaactttataaggacgcaatggag
tatgcatcagagtctggtaaacaagaactagctgaagagttgttgggctggtttttggag
cgtgatgcccatgactgctttgcagcatgcctatatcagtgctacgaattgctacgccct
gatataattttggagttggcctggaaacataaaatattagactttgctatgccctatcta
atacaggttttgcgagaatacaccataaaggttgataaattggagctaagcgaagcacaa
cgagagaaggataatgatagtacagaacaaaaaaatattatacaaatggaaccccaactt
atgattactgcaggtccagctcttggtatttcttcgcaataccctcagaactatccatca
ggtgctacgccaatatcagctgccgttactggacgaaacttgggttatccatatttgtag

DBGET integrated database retrieval system