KEGG   Drosophila ananassae: Dana_GF11223Help
Entry
Dana_GF11223      CDS       T01059                                 

Definition
GF11223 gene product from transcript GF11223-RA
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
dan  Drosophila ananassae
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dan01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dan00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dan00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:dan00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2479 aa AA seqDB search
MLITLLGTLAAFLAFLLTLIFGRGQKRLKPVEVQSPVAATSTLTSATTSKGSNNNNNSSV
IAATATTTTTATNNPAGATTAAGEKRTFPKSCIKKVKFSSESLKSDVEELCEQLKENALN
DRSNDNIRITCHQNNNNSISNKNKNQTSIDNNNTDKMSETNESNETQTQSAEGERPSFLV
GDEIDEKAAEAGEACDEFPQKMQSDIRQNGDISERRKRLRPSMSRGTGLGQDRNQDRDFH
IGTTEEFVKRFGGTRVINRVLIANNGIAAVKCMRSIRRWSYEMFKNERAVRFVVMVTPED
LKANAEYIKMADHYVPVPGGSNNNNYANVELIVDIALRTQVQAVWAGWGHASENPKLPEL
LHKEGLVFLGPPERAMWALGDKVASSIVAQTADIPTLPWSGSELKAQYSGKKIKISSELF
ARGCVTNVEQGLAAVNKIGFPVMIKASEGGGGKGIRRVDTAEEFPALFRQVQAEVPGSPI
FVMKLARGARHLEVQLLADQYGNAISLFGRDCSIQRRHQKIIEEAPAIVAQPEVFEDMEK
AAVRLAKMVGYVSAGTVEYLYDPEGRYFFLELNPRLQVEHPCTEMVADVNLPACQLQIGM
GIPLYRLKDIRLLYGESPWGASVIDFENPPNKPRPSGHVIAARITSENPDEGFKPSSGTV
QELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCFSWGENRQQARENLVIALKELSIRGD
FRTTVEYLITLLETNRFLDNSIDTAWLDALIAERVQSEKPDILLGVMCGSLHIADRHITE
SFSSFQTSLEKGQIQAANTLTNVVDVELINDGIRYKVQAAKSGANSYFLLMNGSFKEIEV
HRLSDGGLLISFEGASYTTYMKEEVDRYRIVIGNQTCVFEKENDPSLLRSPSAGKLINLI
VEDGAHVSKGQAFAEIEVMKMVMTLTSQEAGTVTFVRRPGAVLDAGSLLGHLELDDPSLV
TKAQPCKGQFPQPENAPVPEKLNRVHNTYKSILENTLAGYCLPEPFNAQRLRDIIEKFMQ
SLRDPSLPLLELQEVIASISGRIPISVEKKIRKLMTLYERNITSVLAQFPSQQIASVIDS
HAATLQKRSDRDVFFLTTQSIVQLVQRYRNGIRGRMKAAVHELLRQYYDVESQFQHGHYD
KCVGLVREHNKDDMQTVVNTIFSHSQVAKKNLLVTLLIDHLWANEPGLTDELANTLSELT
SLNRAEHSRVALRSRQVLIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQRLILSE
TSIFDILHDFFYHSNRAVCNAALEVYVRRAYTSYELTCLQHLELSGGLPLVHFQFLLPTA
HPNRLFSRMSSPEGLDQAAAETLGSSFVRTGAIAAFDSFEHFEMYSDEILDLLEDFVSPA
MVNAKVLEAVEAADSISDSRHSTSINVSLSDPVTRANAAEEAKSTEPIHIVSVAVRETGE
LDDLQMAQIFGNYCQEHNEELFQRRIRRITFAALKKRQFPKFFTYRARDKFEEDRIYRHL
EPASAFHLELNRMKTYDLEALPTANQKMHLYLGKAKVSKGQEVTDYRFFIRSIIRHSDLI
TKEASFEYLQNEGERVLLEAMDELEVAFSHPHAKRTDCNHIFLNFVPTVIMDPAKIEESV
TKMIMRYGPRLWKLRVLQAELKMVIRQSPQSPTQAVRLCIANDSGYFLDISMYTEQTEPE
TGIIKFKAYGEKQGSLHGHPISTPYMTKDFLQQKRFQAQSNGTTYVYDVPDMFRQMTERH
WKEFSKARPTVDIRIPDKILIECKELVLEGDSLVEMQRLPGENNCGMVAWRIVLATPEYP
NGREIIVIANDLTYLIGSFGIKEDVLFAKASQLARERKVPRIYISVNSGARIGLAEEVKA
MFKIAWEDPEEPDKGFKYLYLTTEDYAKVANLNSVRAILIEDEGEQRYKITDIIGKDDGL
GVENLRYAGLIAGETSQAYEEIVTIAMVTCRTIGIGSYVVRLGQRVIQIDNSHIILTGYA
ALNKLLGRKVYASNNQLGGTQIMFNNGVTHKTEAIDLDGVYTILDWLSYIPAYIGCDLPI
ILPSDRIDRPVDFMPTKSPYDPRWMLAGRVNPVNANDWENGFFDRDSWSEIMAPWAKTVV
TGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYKTAQAIKD
FGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPNAELRGGA
WAVLDSLINPRYMETYADPEARGGVLEPEGIVEIKYKEKDLVKTIHRLDATTIGLKKEFD
EAVASGDKVKAAQVDEKIKARIAVLMHVYHTVAVHFADLHDTPERMLEKECISEIVAWRD
SRRWLYWRLRRVLLEDAYIKKILRAQDNLSVGQAKQMLRRWLVEEKGASESYLWDKNEEM
VAWYEEQSNAESIVSRNVNSVRRDAIISTISKMLEDCPDVALDAVVGLCQGLTPVNRGVV
VRTLAQMQLNEESSSGNQG
NT seq 7440 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcacactattaggcactctggccgcttttctcgcattcctattgacattgatc
tttggccgcggccagaaaagactcaagccagtggaagttcaatctccagtggcagccaca
tcgaccctcacctcagcaacaacatctaaagggagcaacaacaacaacaactccagcgtg
attgcagctacagcaacaacaacaacaactgctaccaataatcctgcaggagcaactaca
gctgcgggggagaagaggacttttccaaagtcctgcataaagaaagtcaagttctctagc
gagagtctcaagtccgacgtagaggagttgtgcgagcagttgaaggagaacgctctgaac
gatcggagcaacgacaatatccgtatcacctgccatcagaacaacaacaacagcataagc
aacaagaacaaaaaccaaaccagcatcgacaacaacaacactgacaagatgagcgaaaca
aacgaatcaaatgaaacgcaaacccaatccgcggagggtgagcgacccagctttttggtg
ggcgatgagattgacgagaaggccgctgaggcgggtgaggcctgcgacgagttcccccaa
aagatgcaaagcgatatccggcaaaatggcgatatttcggaacgacgcaagcggctaagg
ccaagcatgtcccgcggcactggcttgggccaggaccggaatcaggatcgagactttcac
atcggcaccaccgaggagtttgtgaaacgattcggcggcacccgcgtcatcaaccgtgtc
ctgatcgccaacaacggcattgcggccgtcaagtgcatgcgttccatccgccgctggtcc
tacgagatgttcaagaacgagcgagccgtccgcttcgtggtgatggtcactcccgaggat
ctgaaggccaatgcggagtatattaagatggctgatcactatgttcccgtgcccggagga
tccaacaacaacaactatgccaatgttgagctcattgtggacattgcacttcgcactcaa
gtacaggctgtgtgggccggctggggtcatgcctctgagaatcccaagctgccggagctg
ttgcacaaggagggtctggtctttctcggtccgcccgaacgcgccatgtgggcgcttggc
gataaagtggcctcctcgattgtggcacaaacggccgacattccgaccctgccctggtcc
ggttccgagctgaaggcccagtacagcggcaagaagatcaagatttccagcgaactcttt
gcccgcggctgtgtgaccaatgtggagcagggtctggccgcagtcaacaagattggcttc
cctgtgatgatcaaggcctcggaaggcggcggcggcaaaggcattcgtcgagtggacacg
gccgaggagttccccgcccttttccgtcaggtgcaggccgaggttcccggctcacccatt
ttcgtgatgaagctggccaggggagcccgccatttggaggtgcagctcctggccgatcag
tacggcaacgccatcagtctgtttggtcgtgactgctccattcagcgtcgccaccagaag
atcattgaagaagcccccgccattgtggcccagccggaggtgttcgaggacatggagaag
gccgccgtgcgtctggccaagatggtcggctatgtgagcgctggaactgtggaatacctg
tacgatcccgaaggacgctacttcttcctggagttgaacccccgtctgcaggtggagcat
ccctgtacagaaatggtggctgatgtgaatctcccggcttgccagctgcagattggaatg
ggcattcccctgtaccggctgaaagatattcgtctgctctacggagaatcgccctggggc
gcttccgtcatcgactttgagaatccgccaaacaaacctcgtccttctggccacgttatc
gccgctcgaattacctcggagaaccccgacgaaggcttcaagcccagttcgggtaccgtg
caggaactgaacttccgttccagcaaaaatgtgtggggctacttcagtgtggccgcaagc
ggtggcctgcatgagttcgccgactcccagttcggtcattgcttctcctggggcgagaac
cgtcagcaggcgcgcgagaatctggtcatcgccctgaaggagctgtccattcgcggtgac
ttccgcacaaccgtggagtacctgatcaccttgctggagactaaccgcttcttggacaat
agtatcgacaccgcttggctggatgctctgatcgcggagagagtgcagtccgagaagccg
gacatcctgttgggcgtcatgtgcggctccctgcacattgccgatcggcacatcaccgag
agcttttcaagcttccaaacctctctggagaagggtcagattcaggcggccaacacgctg
accaacgtcgtggacgtggaactgatcaacgacggcatccggtacaaggttcaggccgcc
aagagcggcgccaactcctacttcctgctgatgaacggatcgttcaaggagatcgaagtg
catcgcctctccgacggtggtcttctcatttccttcgaaggcgccagctacaccacctac
atgaaggaggaggtcgaccgctaccgcatcgtaatcggtaaccagacttgtgtctttgag
aaggagaacgatccctcgctgcttcgcagcccctcggccggaaaactgatcaacttgatt
gtcgaggacggtgcccacgtgagcaagggccaggccttcgccgaaatcgaggtgatgaag
atggtgatgacccttacctctcaggaggcaggtacggtgacattcgtccgaagaccagga
gcagtgctagacgctggatctctacttggtcacttggaactggatgatccttcgctggta
accaaggcgcagccctgcaagggccagttccctcaaccagagaacgccccggtcccggag
aagctaaatcgagtccacaacacatacaagagcatcttggagaacaccctggccggttac
tgccttcctgaaccgttcaacgcccagcgcctgcgcgacatcattgagaagttcatgcag
agcttgagggatccctcgctgcccctgctggagcttcaggaagtgattgcttccatatcg
ggacgcattcccatctctgtggagaagaagatccgcaagctgatgaccctctacgagcgc
aacataaccagtgttctggcccaatttccctcccagcagatcgccagcgtcatcgacagc
catgccgccactctgcagaagcgttcggacagggacgtcttcttcctgaccactcagagc
attgtgcagctggttcagcgctaccgcaatggaatccgtggtcgcatgaaggccgccgtc
cacgagctgctccgccagtactacgacgtggagtcgcagttccagcacggtcactacgac
aagtgcgtgggattggtgcgcgagcacaacaaggacgacatgcagacggtggtcaacacc
atcttctcgcactcgcaggtggccaagaagaacctgctggtcaccctgctcattgaccac
ctctgggccaacgagccgggcctgaccgacgagctggccaacactctgagtgagctgacg
tccctgaaccgagcggaacactcccgggtagctctgcgctcccgccaggtgctcatcgcc
gcccaccagccggcctatgaactgcgccacaaccagatggagtcgatcttcttgtcggcc
gtggacatgtacggccacgatttccatcccgagaatctgcagcgtctgatcctgtcggag
acctcgatctttgacattctgcacgacttcttctaccactcgaatcgggcagtttgcaat
gccgccctggaggtttacgtgaggagggcttacacctcctacgagctgacttgcctgcag
cacttggagctctccggcggcctgccgctggtacacttccagttcctactccccactgcc
caccccaacaggctcttctcgcgaatgtcctccccggaaggattggatcaagcggcggcc
gagactctgggcagctccttcgtgagaactggagccatagccgccttcgactccttcgag
cactttgagatgtactcggacgagatcctggatctgctggaggacttcgtgtcgccggcc
atggtcaacgccaaagttctggaggctgtggaggcagcagattccatctcggacagccga
cacagcacttccatcaatgtttcgctctctgacccagtgaccagagccaatgccgccgaa
gaggccaagtccacggaaccaatccacattgtcagcgtggccgtcagagagacgggcgag
cttgatgacctgcagatggcccaaatcttcggaaactactgccaggagcacaacgaggag
ctgttccagcgacgtatacgccggatcacgtttgctgctctgaagaaacgccagttcccc
aagttcttcacgtaccgcgcaagggacaagttcgaggaggatcgcatctataggcatttg
gaacccgcatccgcgttccacctggagctgaaccgcatgaaaacttacgacctggaggca
ctgccgacggccaaccagaagatgcacttgtatcttggcaaggctaaggtatcgaagggc
caggaagtcaccgattaccgcttcttcatccgctccattatccgtcactccgacctgatc
accaaggaagcctcgttcgagtacctccagaacgagggtgaacgcgtgctcttggaagcc
atggacgagctggaggtggcgttctcccacccgcatgccaagcgcaccgactgcaaccac
atcttcctcaacttcgtacccaccgtcattatggatccagccaagatcgaggagtccgtc
accaagatgatcatgcgctacggaccgcgtctctggaagttgcgcgtcctgcaagcggag
cttaagatggttattcgccagtcgccgcagtcccccacacaggctgtgcgactctgcatc
gccaacgattccggatacttcctggacatctccatgtacacggagcaaaccgaaccggag
acaggaatcatcaagttcaaggcctatggcgagaagcagggatccttgcacggacatccc
atctccacgccatatatgaccaaggacttcctgcagcagaagcgtttccaggctcaatcg
aatggcaccacgtacgtctatgacgttccggacatgttccgccagatgactgagcgacac
tggaaggaattctccaaggcccgtcccacggtcgacatccgtattccggataagattttg
atcgagtgcaaagagctggtccttgagggcgacagcctcgtggagatgcagcgactgcca
ggagaaaacaattgtggtatggtggcttggcgcatagtgctagctactccggagtatccc
aatggtcgcgagatcattgtgatagccaacgacttgacctacttgatcggttcctttgga
atcaaggaagatgtgctcttcgccaaggcttcccagttggctcgcgaacgtaaagtgcct
aggatctacatctccgtgaacagcggtgcccgcattggtcttgctgaggaggtgaaagcc
atgttcaagatcgcatgggaggatcccgaggagccggacaagggcttcaagtacctctac
ctaaccaccgaggactacgccaaggtggccaacctgaactccgtgcgcgccatcctgatc
gaggacgagggcgagcagcgctacaagattaccgacatcattggcaaggatgatggcctt
ggcgtggagaatctgcgctatgccggtctgattgccggcgagacgtcccaagcctacgaa
gagattgttaccattgccatggtcacgtgccgtaccatcggtatcgggtcgtacgtggtg
cgtctgggacagcgtgtgatccagatcgacaactcgcatattatactcacgggctacgct
gctcttaacaagctgctcggccgcaaggtgtacgcctccaacaatcagctcggtggcacc
cagattatgttcaacaacggtgtgacccacaagaccgaggccatcgacctggacggagtg
tacaccatcctcgactggctctcttacattcccgcctacatcggctgcgacctgcccatc
atcctgcccagcgatcgtatcgatcggcccgtggacttcatgcccaccaagtcgccgtac
gatccccgctggatgcttgccggccgtgttaacccggtgaatgccaacgactgggagaac
ggattcttcgatcgggactcgtggagcgaaatcatggcgccgtgggccaagacagtggtc
accggtcgcgcccgtctgggcggagttcccgtgggtgtgattgccgtggagacccgcact
gtggaggtcgaaatgcccgccgatcctgctaatctggactcggaagccaagacactgcag
caggctggtcaggtgtggtacccggattcctcgtacaagacggcccaggccatcaaggac
tttggtcgtgaggaactgccactgattgttttcgcgaactggcgtggcttctccggcggc
atgaaggacatgtacgagcagattgtcaagttcggtgcttacatcgttgacggtctgcgg
gagtacaagaagcccgtgctcatctacctgccacctaatgcagagttgcgtggaggagcc
tgggccgtgctggactcgttgatcaacccgcgctacatggagacctacgccgatccggag
gcccgaggaggtgtcttggaaccggagggcattgtcgagatcaagtacaaggagaaggat
ctggtcaagacgatacaccgcctggacgccaccacgattgggctgaagaaggagtttgac
gaggcggtagcatcgggagataaggtcaaggctgcccaggtcgatgagaagattaaggct
cgcatcgcggtattgatgcacgtctaccacacggtggccgtccactttgccgacctgcac
gacactccggagcgcatgctggagaaggagtgcatcagtgagattgtggcgtggcgtgac
tcgcgccgttggctatactggcgcctgcgccgtgtcctcttggaggacgcttacattaag
aagatattgcgggcgcaggacaacctgtccgtgggccaggcgaagcagatgctgcgacgc
tggctggtcgaagagaagggagcctctgagtcgtatctgtgggacaagaacgaagagatg
gtggcctggtacgaggagcagagcaatgccgaatccattgtttcccgcaacgtgaattcc
gtgagaagggatgccattatttcgaccatttccaaaatgctcgaggactgtcctgacgta
gcgctggacgctgtggtgggtctttgccaaggtctgacgcccgtgaatcgtggcgtggtc
gtacgcacactggcgcagatgcagctgaacgaggagagctcatctggcaaccagggatga

DBGET integrated database retrieval system