KEGG   Drosophila ananassae: Dana_GF11268Help
Entry
Dana_GF11268      CDS       T01059                                 

Definition
GF11268 gene product from transcript GF11268-RA
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
dan  Drosophila ananassae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dana_GF11268
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dana_GF11268
   00600 Sphingolipid metabolism
    Dana_GF11268
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    Dana_GF11268
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dana_GF11268
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dana_GF11268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 417 aa AA seqDB search
MYGTWRCLLGGILLLQLLRSGQALDNGLARTPPMGWMSWERFRCITDCKLYPNECISENL
FSRHADLLVSEGYAAAGYEYVIIDDCWLEKNRDSKTQKLVADKKRFPSGLNALADHIHEI
GLKFGLYQDYGTNTCAGYPGVINHMKLDAQTFAEWDVDYVKLDGCYANISDMAVGYPEFG
RLLNETGRPMVYSCSWPAYQEPAGEMPDYESLKKHCNLWRNWDDIDDSLESLMQIMDYFG
KNQDRIQPQAGPGHWNDPDMLLLGNYGLSYDQSKLQMAIWAIMAAPLIMSNDLEAVRPEI
KAILQNRAVIAVDQDELGIQGRRVATRNQIEVWQRPITPVAKNGHHSYAVAFVSRRDDGA
PYRITFTIKELGLKNPNGYTVQDLYDSSRNLGVFKNGSEFVTRVNPNGVTFYKFTAL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaacttggagatgccttctgggtgggattctcctgctgcaattgctccgaagt
gggcaggctttggataatggtctagcacgaacgccacccatgggttggatgtcctgggag
cgcttccgttgtatcaccgactgtaagctctatcccaacgagtgcatcagtgagaatctg
ttctcacgccatgctgaccttctggtctcagagggctatgccgctgctggctacgaatat
gtgattattgatgactgctggttggagaagaatcgggacagtaagacccagaaactagtg
gctgacaaaaagcgattcccaagtggactaaatgctctagcggatcatatccacgagata
ggtctcaagtttggattgtaccaggactatggaaccaatacctgtgccggctatcctggt
gtaatcaatcacatgaagttggatgcccagaccttcgccgaatgggatgtggattacgtc
aagctggatggctgttatgccaacatcagtgacatggccgtgggctacccggagtttgga
cgccttttgaatgaaacgggcaggccaatggtctactcctgcagctggccagcctaccaa
gagccggctggagagatgcccgactacgagtctctcaagaagcattgcaatttgtggcgc
aactgggacgatattgatgattcactggaatccctgatgcagataatggactactttggc
aagaaccaggacaggattcaaccacaagctggacctggtcattggaacgaccccgatatg
cttctgctgggaaactacggactcagctacgaccagagcaagctgcagatggccatttgg
gcgatcatggcggcgcctcttatcatgtccaacgatttggaggcagttcgtcctgagatc
aaggctattctacagaatcgagctgtgattgcagtggatcaggacgaattgggcatccag
ggacgtcgggttgcgacccgtaatcagatagaagtctggcagcgacccatcactcccgtg
gccaaaaacggacaccactcctatgccgtggcctttgtgagccggcgggatgatggagct
ccctacagaatcaccttcaccatcaaggaactcggcttgaagaatcccaatggctacacg
gtccaggatctgtacgattctagcaggaatctgggtgtcttcaagaacggcagcgagttc
gtcacacgcgtcaatcccaatggcgtaactttctacaagtttactgcgctgtaa

DBGET integrated database retrieval system