KEGG   Drosophila ananassae: Dana_GF11268Help
Entry
Dana_GF11268      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01189  alpha-galactosidase [EC:3.2.1.22]
Organism
dan  Drosophila ananassae
Pathway
dan00052  Galactose metabolism
dan00561  Glycerolipid metabolism
dan00600  Sphingolipid metabolism
dan00603  Glycosphingolipid biosynthesis - globo and isoglobo series
dan04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dana_GF11268
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dana_GF11268
   00600 Sphingolipid metabolism
    Dana_GF11268
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    Dana_GF11268
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dana_GF11268
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dana_GF11268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase
Motif
Other DBs
NCBI-GeneID: 6494132
NCBI-ProteinID: XP_001960903
FlyBase: FBgn0088308
UniProt: B3MFN5
Position
Unknown
AA seq 417 aa AA seqDB search
MYGTWRCLLGGILLLQLLRSGQALDNGLARTPPMGWMSWERFRCITDCKLYPNECISENL
FSRHADLLVSEGYAAAGYEYVIIDDCWLEKNRDSKTQKLVADKKRFPSGLNALADHIHEI
GLKFGLYQDYGTNTCAGYPGVINHMKLDAQTFAEWDVDYVKLDGCYANISDMAVGYPEFG
RLLNETGRPMVYSCSWPAYQEPAGEMPDYESLKKHCNLWRNWDDIDDSLESLMQIMDYFG
KNQDRIQPQAGPGHWNDPDMLLLGNYGLSYDQSKLQMAIWAIMAAPLIMSNDLEAVRPEI
KAILQNRAVIAVDQDELGIQGRRVATRNQIEVWQRPITPVAKNGHHSYAVAFVSRRDDGA
PYRITFTIKELGLKNPNGYTVQDLYDSSRNLGVFKNGSEFVTRVNPNGVTFYKFTAL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaacttggagatgccttctgggtgggattctcctgctgcaattgctccgaagt
gggcaggctttggataatggtctagcacgaacgccacccatgggttggatgtcctgggag
cgcttccgttgtatcaccgactgtaagctctatcccaacgagtgcatcagtgagaatctg
ttctcacgccatgctgaccttctggtctcagagggctatgccgctgctggctacgaatat
gtgattattgatgactgctggttggagaagaatcgggacagtaagacccagaaactagtg
gctgacaaaaagcgattcccaagtggactaaatgctctagcggatcatatccacgagata
ggtctcaagtttggattgtaccaggactatggaaccaatacctgtgccggctatcctggt
gtaatcaatcacatgaagttggatgcccagaccttcgccgaatgggatgtggattacgtc
aagctggatggctgttatgccaacatcagtgacatggccgtgggctacccggagtttgga
cgccttttgaatgaaacgggcaggccaatggtctactcctgcagctggccagcctaccaa
gagccggctggagagatgcccgactacgagtctctcaagaagcattgcaatttgtggcgc
aactgggacgatattgatgattcactggaatccctgatgcagataatggactactttggc
aagaaccaggacaggattcaaccacaagctggacctggtcattggaacgaccccgatatg
cttctgctgggaaactacggactcagctacgaccagagcaagctgcagatggccatttgg
gcgatcatggcggcgcctcttatcatgtccaacgatttggaggcagttcgtcctgagatc
aaggctattctacagaatcgagctgtgattgcagtggatcaggacgaattgggcatccag
ggacgtcgggttgcgacccgtaatcagatagaagtctggcagcgacccatcactcccgtg
gccaaaaacggacaccactcctatgccgtggcctttgtgagccggcgggatgatggagct
ccctacagaatcaccttcaccatcaaggaactcggcttgaagaatcccaatggctacacg
gtccaggatctgtacgattctagcaggaatctgggtgtcttcaagaacggcagcgagttc
gtcacacgcgtcaatcccaatggcgtaactttctacaagtttactgcgctgtaa

DBGET integrated database retrieval system