KEGG   Drosophila ananassae: Dana_GF11329Help
Entry
Dana_GF11329      CDS       T01059                                 

Definition
GF11329 gene product from transcript GF11329-RA
Orthology
K04437  
filamin
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2968 aa AA seqDB search
MDVKDIKGAKVTHAGLLKHNSDGTTETQKITHAGLVARSPEGTAAKGMNIRGNEDLWVEI
QANTFRNWVNEHLRETGMQVHDWATDFCDGTCLCALVESLQTRPLKPSWNRRPANQHHYL
ENATTALKSIEADHIKLVNIGNVDIVNGNVKLILGLIWSLIVRYQIGRSKFPPRKLMLAW
LQAALPDCKITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCTQAMDMAQRE
FGVPKVLEPEYLASPWLDELSGMTYLSYFMKPGGPGYNATMRWVNTQVKDPVKNFTTDWN
DGRVMCEIIKGLGGSAPAPEKLSTDPFHYENNIRKAVDAGARLGVQPILTAKDMANPEVE
HLGIMAYAAHLQWVPPRPPLSDLINVYLESTSGRVGEPTHFRIDVLSRDISLSSVRCHVM
PPSGQPGQPVRLNTHGEGVYVPERYGMHEIVVEIGEDSLGGHFFRVLPRLLQVAPPGMAP
CALGSLVEVLVNATGAPKTEDILVTAVSPTGISHNCPLKKIDEGHSAIFKPDEAGIWEIA
ITYQGRHIQGGPFTCAVFDSSGVSVHGLDGAMPLRAHTFEVDARGVGVSGELHVDIVHDK
HSLVCSVEKIVENKYRVTFMPRQNGKYRVYIYFNGYDVKGSPFIMRVGTKGRSGKTRSSP
LHDSKHRSESPSMHFISTTNTRHNDYRNSSLSRHNTAERTNSYSPQYSPKLDTTDYHSSS
SRYYKRESEENHTSPPPVSGSPTVKYLNSADLYTETLNGARRDSKASNSSSTKNDYYFDK
ENELYSQRRGVTKPKLAPPREEREVTSTSSSSSFQQRHQQLATSTLTRSLSPIPSPTLNT
RSSEVHTHSPLTIKTSNQYESSTRNVSNSPRHASVSPVQRYSPNSAYITTATHRMGSPVT
NTLNKNGYETTRTVEKSSTYKSTSNYVTDSNVRASPSLYGTTERLRRTGSPEPRIDHSSN
VRVSSMKPASARRDSWDVINKTKHMLSHNSLESLANMTETQLNTELQYNRPDLDHETHRN
TQYNKFALHKQQQQQSDYRRDSPDDGERYKPSAITVKSHSNNTYTDKSGGYTKTVKESSE
HVVTESNGHGPSPGYGYSSLSRFRPIDNNATGARAIRVQDIPNGSIGRPVEFEIDGSKAG
SGNLEILVNGGRVTSSVRSLGGQRFVASFTPHEHGTHTVQITFNGETVPGSPWHAEIMSS
PGLTALGESTRLVPANTPAVFEILPPPGQSLSKGECVATVLTPSKSKLNARVTHEAANGA
ARIEFVPTEVGTHVIDASINGTKIAGGPLIAKVYDSSLIQVTEVNGGVVGQPCQFRVDAS
AAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQAKSHLIDIKFNGETVRGCPFVCAV
ADTSRVLLNLSNLELIPVNRPSSFHITVSGGGAAELAVSVRGPQGELPVRVTGDIHAGFT
AEFTPTTVGGHSINVEYNGFAVQGTPFLAKSYDATKVVVGSVSRGTMGRPVQFTVDAGDA
GEGNLEITISAKGQNIPTQVHPQGSARFSVSFVPTESCEHTINVSFNKMPVPGCPITVSI
SGGVAGPQVSLGGPGPVHQTNSFVINHNGGRLEDIEVNVEGPAGQSVPAQVHQSADGVFK
AEFVPRVVGEHRVNVTVNGLATAGSPYAAKVYDVSAIKVKNVSSGTVGKPVTFLVETSQA
GPGNLEVTVNGGRVPTSAQAQGQHTYAISFTPREAESHTVELRFNSQDVPGSPFTCRVAA
AARIQSPESMDKVSVGRLFEFVVESDTKPTVEVLGPARRSVPVKIDPLGSSTLGYNVKFE
PMEVGDHSVEVRLPGGGHVEGSPFLLKAYSAEKVIVTDIRSGVVNKSVSFGINASQAGAG
NLEIIVAVNGKNVPNFVQSEGNARFKVNFKPTEAATHSLSVRFNGHPVPGSPFSCHIAAA
AASPSMGLPRAMAMGECLKQAAVKMDNTFELEGFEGVEPQIFVTSPSGDNEHCQLSQHDG
GSYSASFRPTTVGRHLISVTANDQHINGSPFSCNVFDVSRVSISGLEQQYGPATLGVPVT
FSVDAAGAGEGTLELVVSTDSSTVKAEVVACARGLYDVTFVPQSTEPHYVNITFNEVAVD
GSPFRVDIQQHTQHIQIGSLAAIDFPADDQIVEIFSPDQKSVPYSINRQTAEFRTHSTGN
YTLRFIDRETRQHIGSRTLCVFDPTLVKITEVSEAFCHRPASIGVSLNEAGQGDLSALVR
CGATEVPHTIRGPSKSGVYEIVYQPTRVAPHKISILFNDVPISLKPLEINVLPASAGKEI
SVSGLGLYQARVGKTTSFAIDTVKRPAREFDVVVSGPGGQALPVRCYQTKNGHLQAEFTI
NKPGQCVIEVLHQSKPLPGSPFTCESFDSSKVTTQGITKEPLALHSPNSFTVRTDNAGTA
ELEAFAISPSNQSLPVLISEQSDGVYNVEFVPSQPGNYKLTLMYGGETIPSSPLNFTASS
SGVRNDARAAGHGLEVCHRNKEASFVVYCPIAPNVQIERLDEYGERIEPKIKALGNNEWR
ISYTILSVGKYEIRASCPNRGSLPGSPWHISCVESNKVSPVGGWGTLVDHDGRLILPARI
IFDVENAGPGKLVCSIDGIEIPVDKFADDKMCLNITGENLAAGEHDLDLTWSGLTITQCP
RSAYVTGQQAADKVQLMGRGLAAAQAGEAAHFTIDASNAPAGKPEVILIAQDNSSLPVSL
AQPRPSENIWVASYTPQKSTTGTLNLSVKWNGRLVKGCPLTVAVGSSMDASKVIASGEGL
RHGIVGKDIKSWIDTRRAGPGELTAHCAGVRKVAYCELYDHGDATFTLNIKPQEPGRHLL
TIKYGGQNVPGSPFALKVAGAPDASKVRVYGPGIEHGVLATFQSRFICDTRGAGAGQLTV
RVRGPKGAFRVEMQRESQKDRTILCKYDPTEPGDYRVEVKWAGEFVPGSPFPVMIFDTEE
ELRSGLGTLPLGHGQGVPRRKAPSCTPL
NT seq 8907 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaaggacataaagggcgccaaggtgacgcacgcggggctgctgaagcacaac
tccgatggcaccaccgaaacgcaaaagatcacccacgccggcctggtggcccggagtccc
gagggcaccgccgccaagggcatgaacatccggggcaacgaggatctctgggtcgagatc
caggcgaatacgttccgcaattgggtcaacgagcacctgcgcgagacaggaatgcaggtc
catgactgggccacggatttctgcgacggcacctgcctctgcgccctcgtggagagtctg
cagacccgaccgctgaagccctcgtggaaccgccgccccgccaaccagcaccactacctg
gagaacgccaccacggcgctcaagtccatcgaggcggaccacatcaagctggtgaacatc
ggcaatgtggacatcgtcaatggcaacgtcaagctgatcctgggcctcatctggtccctg
atcgtgcgctaccagatcggaaggagcaagttcccgccgcgcaagctgatgctcgcctgg
ttgcaggccgctctgccggactgcaagatcaccaacctgaccaccgactggaacagcggc
gtcaacctggcggctctcctggactactgccagccgggtctattccctcactggcgcagc
ctggatcccagtcagagcgtgaggaactgcacccaggccatggacatggcgcagcgggag
ttcggcgttcccaaggttctcgagccggagtacctggcctcgccctggctggatgagctg
tccggcatgacgtacctatcgtacttcatgaagcccggcggacccggctacaatgccacc
atgcgctgggtcaatacccaggtcaaagatcctgtcaagaatttcacgaccgattggaac
gatggacgtgtcatgtgcgaaattatcaagggactgggtggttcggcccccgccccggaa
aaactcagcaccgatccgttccattatgaaaacaatattcggaaggcggtggatgctggt
gcccgtctgggcgtgcagcccatccttacggccaaggacatggccaacccggaagtggag
cacctgggcatcatggcgtacgcggcccacctgcagtgggtgccgccaaggccaccgctc
tccgacctcatcaacgtctacctggagagcacatccggccgggtgggcgaaccgacgcac
ttccgcatcgacgtgttgtcccgggacataagcctcagctccgtgcgctgccacgtgatg
ccgccatccggacaacccggccagcctgtccggctcaatacccacggcgagggcgtctac
gtgccggagcgatacgggatgcacgagattgtggtggagataggcgaggatagcctggga
ggacacttcttccgggtcctgccccgtttgctgcaagtggcgccacccggaatggccccc
tgcgccctgggcagtctcgtcgaggtgctggtgaatgccaccggggcgcccaagacggag
gacatcctggtgacggccgtctcgccaactggcatctcgcacaactgtccgctgaagaag
atcgacgagggtcacagtgccatattcaagccggacgaggcgggcatttgggagatagcc
atcacctaccagggccgccacatccagggcgggcccttcacctgtgccgtgtttgactct
tcgggcgtatccgtccacggactggacggagccatgcccctccgggcccacaccttcgag
gtggacgcccggggagtgggtgtgtccggggaactccacgtggacatcgtccacgacaag
cactcgctagtctgttccgtggagaagatcgtggagaacaagtaccgcgtgaccttcatg
cccaggcagaacggaaagtaccgagtctacatctacttcaatggctacgatgtcaaggga
tccccgttcatcatgcgcgtgggcaccaagggaagatcaggaaagacgcgaagcagccca
ctccatgacagtaagcaccgctcggagagcccttcgatgcacttcatctcgacgaccaac
accaggcacaacgactaccgcaactcctcgctgtcgaggcacaatacggctgagaggact
aacagctactcgccacagtactcccccaagctggacactaccgactaccacagttccagc
tccaggtactataagcgggagagcgaggagaaccacacctcgccgcccccagttagcggc
tcgccgacagtgaagtacctgaactccgctgacctatacacggagaccctgaacggggcc
cggcgcgactcgaaggcctctaacagcagctccaccaagaacgactactacttcgacaag
gagaacgagctgtacagccagaggcgcggggtgacgaagcccaagctggcgccgccgcgc
gaggagcgcgaggtgaccagcaccagcagcagcagcagtttccagcagcgccaccagcag
ctggccaccagcaccctgaccagatcgcttagcccaatacctagtcccacactcaatacc
cgctccagcgaggtgcacacccacagcccgctgaccatcaagacctccaaccagtacgag
agctccactcgcaacgttagcaacagtccgcggcatgcatccgtctcgccggtgcagcgc
tactctccgaacagtgcgtacatcaccacggccacccacaggatgggcagtccggtgacc
aataccctcaacaagaatggctacgagactacgcgcaccgtggagaagtcctccacctac
aagtccacttcgaactacgtcaccgactccaatgtccgtgccagcccctcgctgtatggc
accactgaaaggctgcggcgaaccgggtcgccggaaccgcgcatcgaccactcctccaac
gtgagggtgtcctcgatgaagccggcatccgcccggcgggacagctgggacgtgattaac
aagacaaagcacatgctctcgcacaattcgctcgaatcgctggcgaacatgacagagacg
cagctgaacacggaactgcagtacaatcgtccggatctggaccacgagacgcaccggaat
acgcagtacaataagtttgcgttgcacaaacagcagcagcaacagtcggactatcgccgg
gattccccggatgatggagagcgctacaaaccaagtgccattacagtcaagtcacactcg
aacaatacctacacagacaagtcaggtggatataccaagaccgtaaaggagtccagcgag
cacgtggtcaccgagagcaacggccacggcccgtcgccgggctacggctacagctccctc
tctagatttcggcccatagacaacaatgccactggtgctagggccatccgggtgcaggat
attccgaacggctccatcggacggcctgtggagttcgagatcgatggctccaaggcgggc
tccggtaacctggagatcctcgtcaacggcggtcgagtcacttcctccgttcggtcgttg
ggtggccagagattcgtggccagcttcacgccgcacgagcatggaacgcacacagtgcag
atcacctttaatggcgaaacagttccaggttcaccgtggcacgctgagatcatgtcctca
cccggcctgaccgctctgggcgaatcgacgcgcctggtacccgccaatacgccggcggtt
tttgagatactgccgcctcctggacaaagcctgagcaagggcgagtgcgtggccacggtt
ttgactcccagtaagtcaaagctcaacgccagagtcacccacgaggcggcaaatggtgct
gcacgcatcgagttcgtgcccacagaggtgggcacccacgtcatcgatgcgtccatcaac
ggcacgaagatcgctggcggcccgctgatcgccaaggtctacgactccagcctgatccag
gtgacggaggtgaatggcggcgtggtcggccagccgtgccagttccgcgtggacgccagc
gcggcgggcgagggccagctggagatatccataaatgagggcgaggtgcccaatcacgtc
caggtggtgggtggcggccggtgcctagtctccttcaccccggagcaggccaagtcgcat
ctaatcgacatcaagttcaatggcgagacggtacgcggctgcccctttgtctgcgccgta
gcggacacgtcccgtgtgctcttgaatctctccaatctggagctgattccggtcaaccga
ccctcctccttccacataaccgtcagtggaggaggggcagccgagctggcggtgagtgtt
cggggtccccaaggggagttgcccgttcgcgtgactggagacatccacgccggcttcacc
gccgagttcacgcccaccaccgtcggcggccactcgatcaatgtggagtacaacggcttc
gccgtgcagggcacccccttcctggccaagtcttacgacgccaccaaggtcgtggtgggc
agtgtatcccgcggcacaatgggtcgtccggtgcagttcacggtggacgcaggcgatgcc
ggtgagggcaacctggagattacaatttcggccaagggacagaacatccccacccaggtg
catccgcagggcagtgcaagattctccgtttcgtttgtgcccaccgaatcgtgcgagcac
acgatcaacgtgtccttcaataaaatgcccgttcccggctgtccgatcacggtcagcatc
agcgggggcgtggccggaccccaggtgtcgctcggcggcccgggtcccgttcatcagacc
aattcttttgttataaatcacaacggcggccgtctggaggacatcgaggtgaacgtagaa
ggacctgctggccagtcggtgcctgcccaagtgcatcagtcggctgatggagtcttcaag
gccgagtttgtaccccgagtggtgggcgagcatcgcgtcaatgtcacggtcaatggattg
gccaccgctggaagtccctatgcagccaaggtctatgatgtcagcgccatcaaggtgaag
aatgtcagcagtggaaccgtgggcaagcccgttaccttcttggtcgagacctcccaggct
ggacccggcaacttggaggtcactgtcaacggtggcagggtgcccacctcagcccaggcc
cagggacagcacacctatgccatcagcttcacccctcgggaagccgagagtcacacggtg
gagcttcgattcaatagccaggatgtgcccggatcccccttcacgtgccgagtggcagcc
gcagcccgcatccagtccccagaaagcatggacaaagtgagcgtgggtcggctatttgag
ttcgtggtggagtcggacacaaagcccactgtggaggtgctgggaccagcacgtcgtagt
gtgcccgtcaagatcgatcccttgggaagctctaccctcggatacaatgtcaagttcgag
ccaatggaggtgggtgaccattccgtggaggtgcgcctgccaggtggtggccacgtcgag
gggagtcccttcctgctgaaggcctactcggccgagaaggtcatcgtgaccgacatacga
tccggtgtggtgaacaagagcgtcagctttggcataaacgcctcccaggcgggagccgga
aatctggagatcatcgtggcagtgaatggcaagaatgtgcccaattttgtccagtctgag
ggcaatgcccgtttcaaggtgaacttcaagcccacggaggcggccacccactcgctgtcc
gtgagattcaacggacacccggttcctggatcacctttcagctgccacatcgccgctgca
gcagcttcgccgtcgatgggactgccccgagccatggccatgggcgagtgcctcaagcag
gccgccgtgaagatggacaacactttcgaactagagggctttgagggcgtggagccgcaa
atcttcgttacatcgccctcgggcgacaacgagcactgccagctcagccagcacgacgga
ggcagctactccgcctcattcaggcccaccaccgtgggtcgccacttgatcagtgtgact
gccaatgaccagcacatcaacggctctcccttcagctgcaacgtctttgacgtttcccgg
gtgagcatcagcggcctggaacagcagtacggacccgccacattaggagttccggtgacc
ttcagtgtggatgccgccggagccggcgaaggcactctggaactggttgtttccaccgac
agcagcactgtcaaggccgaggtggtggcctgtgcccgtggactttacgacgtgactttc
gtgccacagagcacggaaccgcactatgtgaatataactttcaacgaggtggccgtcgat
ggaagccccttccgtgtggacattcagcagcacacccagcacattcagatcggcagcctg
gcggccattgatttcccggcagacgaccagattgtggagatcttctcgccggaccagaag
tcggtgccctactccataaatcgccagacggccgagttccgcacccattcgaccggaaac
tacacgctgcgctttatcgatcgcgagacccggcagcacatcggctcccgaaccctgtgc
gtcttcgatcccacgctcgtcaagattaccgaggtgagcgaggccttctgccatcgtccg
gccagtattggagtctctctgaacgaggctggccagggagatctgtctgcccttgtccgg
tgtggagcaacggaagtgccgcataccatccgtggccccagcaagtccggggtgtacgag
atcgtctaccagcccacccgagtggctccgcacaagatcagcatccttttcaacgacgtg
cccatctcgctgaagcccctggagatcaatgtgctgcccgccagtgccggcaaggagatc
agtgtcagtggcctgggactgtaccaggctcgagtgggcaagaccacgtcctttgcaatt
gatactgtgaagagaccggcgcgggagttcgatgtggtggtttcgggacccggaggacag
gctctgccagtcagatgctatcagaccaagaacggtcacctgcaggccgagttcacaatc
aacaagccaggacagtgtgtgattgaggtgctccaccaatcgaaaccactgcctggcagt
cccttcacctgcgaatcctttgatagcagcaaggtgaccacccaaggcatcaccaaggag
ccccttgccctgcacagtcccaacagcttcaccgtgcgcacggacaacgccggaacagcc
gaactggaggccttcgccatatcgcccagcaaccagagcttgcccgttttgatcagcgaa
cagtccgatggagtctacaacgtggagttcgtgccctcgcagcctggcaactacaagctg
accctgatgtacggaggagagactattcccagctccccgctcaacttcacggcctcgtcc
agcggggtcagaaacgatgctagggccgcaggacacggcctggaggtgtgccacaggaat
aaggaggcctcctttgtggtctactgcccgatcgccccgaacgttcagatcgagcgactg
gacgagtacggcgagaggatagagccgaagatcaaagctttgggcaacaatgagtggcgc
atctcgtacaccatcctctccgtcggcaaatacgaaatccgggctagctgtccgaatcgc
ggaagcttgccgggatcgccttggcacatcagctgcgtcgagtctaacaaggtatcgccc
gtgggcggctggggaactctggttgatcacgatggcagacttatcctgcccgctcgcatc
atcttcgatgtggagaacgcgggtccgggaaaactggtgtgcagcatcgatggcatcgaa
attccggtggacaagtttgccgacgacaagatgtgcctgaacattaccggcgagaatctg
gctgccggagagcacgatctggacttgacctggagcggcctcaccatcacccagtgcccg
agaagcgcttatgtgacggggcagcaggcagcggacaaggttcagctgatgggtcgtggc
ttggcggcagcccaggccggagaggcggcccacttcactatcgacgcttcgaatgcaccg
gcaggcaagccggaggtgatcctcatcgcccaggacaactcgtcgctacctgtcagcttg
gcacagccccgtcccagcgaaaatatctgggtggcgtcctacaccccgcagaagtccacc
actggtactctgaatctctccgtcaagtggaacggtcgtctcgtcaaaggttgtcccctc
accgtggcggtgggctcttcgatggacgcctccaaggtgatcgcctctggcgagggcctg
cgtcacggtattgtcggcaaggatatcaagtcctggatagataccaggagagctggcccc
ggcgaactaaccgcccactgtgccggggtgcgtaaggtggcctactgcgagctctacgat
cacggcgatgccactttcaccctgaacataaagccccaggagccgggtcgtcatctgttg
accattaaatacggaggacaaaatgtgccaggatcgccgtttgccctgaaagtggccgga
gctccagacgccagcaaggttcgtgtctatggtcctggcatagagcacggtgtgctggcc
accttccagtcgcgcttcatctgcgacacccgtggagctggagccggacagctgacagtc
cgtgtccgtggacccaagggagccttccgcgtggaaatgcagcgggagagccaaaaggat
cgcaccattctgtgcaagtacgatcccacggaacccggcgactatagagtggaggtcaag
tgggccggagagttcgtgcccggctcacccttccccgtcatgatcttcgacaccgaggag
gagttacgaagtggcctcggcaccctgcctctcggccacggccaaggagttccgcggcgc
aaggccccctcctgcacgcccctgtag

DBGET integrated database retrieval system