KEGG   Drosophila ananassae: Dana_GF11342Help
Entry
Dana_GF11342      CDS       T01059                                 

Definition
GF11342 gene product from transcript GF11342-RA
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
dan  Drosophila ananassae
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dan03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 686 aa AA seqDB search
MAKKHAGADANDSDYNEEPNFEDPPGFVDTISDEDLLGDMLAQRPSEADGVESVVVVDNI
PKVEPVRLEKLKSVINKLFSHCGDIVNVVYPVDEEGKTKGYAFMEYKHASQAEDAVKKLN
NHRLDKNHTFAVNLFTDFQKYENIPEKWEPPTIQTFKVQSDLYNFINDPDAYDQYCVAAE
TAPNCVQVGFWQNTLPEPSELETRERFTDTFVKWSPLGTYVVTFHKPGVAIWGGSNFQKI
QKFPHPGTQFVEFSPCENYLVTYGPTPTGQKIIIWDIRTGAEKRSFVADGMSVLSMFRWS
HDDKFVARMGENSIHIYETPSFYLLDLKSIKIPGIRGFSWSPTDNVIAYWVEEQNQIPAR
VTLMEIPKKREIRNKNLFHVADCKLHWQKSGDYLCVKVDRYSKLKKDKKELDVKFLGMFY
NFEIFHMREKEIPVDSVEIRELILAFAWEPIGNKFSIIHGEPNSSNVSFYEVNKGVKPSL
VKRLEKKSCTHLFWSPRGQFIVMANLTMGTFEFVDSTNDYIISASPDHFRASEVEWDPTG
RYVVTGVSSWKVKEDTGFNMYTFQGRIIKRTILKNFVQFLWRPRPPTLLAEEKQKEIKKN
LKKYYAVFEQKDRLRLTRASKELLEKRAQLRETFMEYRNKRIAEWKDQKSRRVMLRGHVD
TDNLETEEVDEEIVEFLVKEEITLLE
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaagcacgcgggcgccgacgccaacgacagcgactataatgaagaaccaaac
ttcgaggatcctcccggctttgtggacaccatcagcgatgaagatctgctcggcgacatg
ctggcccaacgcccctcggaggcggatggcgtagaaagcgttgtggtggtggataacatc
cccaaggtggagccggtgcgcctggagaaactcaagtccgtgatcaacaagcttttctct
cactgcggtgacattgtcaacgtagtctatcccgttgacgaggagggcaagaccaagggc
tacgccttcatggagtacaagcacgccagccaggccgaggatgctgtcaagaagctgaac
aaccaccgtctggacaagaaccacacgtttgctgtcaacctgtttactgattttcaaaag
tacgagaacatccctgaaaagtgggagcctccaaccattcagaccttcaaagtacaaagc
gacttgtacaacttcatcaacgatcccgatgcatacgatcaatactgcgttgccgctgag
accgccccgaactgcgtgcaggtgggcttctggcaaaacaccctgcctgagccgagtgag
ctggagacccgcgaacgcttcaccgacaccttcgtcaagtggtcgcctttgggaacttat
gtggtcacgttccacaagccaggtgtagccatctggggcggcagcaacttccagaagatc
cagaagttcccccatcccggcacccagttcgtggaattctcgccctgcgaaaattatctg
gtcacctacggacccacgcctacgggacagaagatcataatctgggacatccgcactgga
gccgagaagcgttcgttcgtcgccgacggtatgtcggtgctgtccatgttccgctggtcg
cacgatgacaagtttgttgcccgaatgggtgagaactcgattcacatctacgagacgccc
tcgttctacctgctcgacttgaaatctatcaagattcccggcatccgcggattctcgtgg
tcccctacggacaacgttatcgcttactgggtggaagagcagaaccagattcccgcccgt
gtcaccctgatggagatccccaagaagcgcgagatccgtaacaagaacctgttccacgtg
gccgactgcaagctgcactggcaaaagtctggtgactatctctgcgtcaaggtggaccgc
tactccaagctgaagaaggacaagaaggagttggacgtgaagttcctgggcatgttctac
aactttgaaatcttccacatgcgcgagaaggagatccctgtcgactcggtggagatccgc
gagctgatccttgccttcgcctgggagccaatcggcaacaagttctccattatccacggc
gaacccaactcctccaacgtcagcttctatgaggtgaacaagggcgtcaagcccagcctg
gtgaagcgtctcgagaagaagtcctgcacgcatttgttctggtcgccgcgcggccagttt
atcgtgatggccaacctcacgatgggcaccttcgagtttgtggactcgaccaatgattac
atcatcagcgcctcgcctgatcacttccgcgcctccgaagtcgagtgggaccccactgga
cgttatgtggtgactggtgtctcttcatggaaggtgaaggaggataccggtttcaacatg
tacacgttccagggccgcatcatcaagcgcacaatcctcaagaacttcgtacagttcctg
tggcgcccacgtccccctaccctgctggctgaggagaagcaaaaggagatcaagaagaac
cttaagaagtactacgctgtcttcgagcagaaggatcgccttcgccttacccgcgcctcc
aaggagctgctcgagaagcgcgcccaactgcgcgagacctttatggaatatcgcaacaag
cgcattgccgaatggaaggaccagaagagtcggcgcgtcatgctgcgagggcatgtggat
acagataacttggaaaccgaggaggtggatgaagagattgttgaatttttagtcaaggaa
gaaataaccctgctggagtag

DBGET integrated database retrieval system