KEGG   Drosophila ananassae: Dana_GF11396Help
Entry
Dana_GF11396      CDS       T01059                                 

Definition
GF11396 gene product from transcript GF11396-RA
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 326 aa AA seqDB search
MESVNSAQMPDSPPQMKRQKMSNPKGSGCGDPFSYEELNIIGTGAYGTVYKARDVKTGNI
VAIKKVRISLNENGVPMSTLREISLLKQLNASDHENIVKLFEVCQFLERDGHLMVLLVFE
HLEQDLSDFIDSLPKTGMPVSTVQRFARELLTGVDFLHIHRIVHRDLKPQNLLVSAQGHL
KIADFGLAKTYDAEMKLTSVVVTLWYRAPEVLLCQSYSSAVDIWSCACIIFEMFNRRAMF
PGNSEKNQLDRIFELTGRPSEKDWPATISVSREQFPQRLPKRPKDFCPSLCEFSDDLLHK
MLSYDMRVRPPALTCLQHEFFKQEYL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgtgaactccgcccaaatgccggactcgccgccccaaatgaagcgccagaag
atgtccaatccgaagggatccggatgcggagatcccttcagctacgaggagctcaacatc
attggaacaggggcctatggaaccgtctacaaagctcgggacgttaaaaccggaaacata
gtggccataaagaaagtgcggatctccttgaacgagaacggagtgcccatgtccacactg
agagaaatttccctgctcaaacagctgaatgccagcgatcacgagaatatcgtcaaactt
ttcgaagtatgccagtttctggagcgggacggccatctgatggttcttctggttttcgag
cacctggagcaggatctgtcggacttcattgatagtttgcccaaaaccggcatgccagtc
tccacagtgcagcgcttcgcccgcgagcttctaactggcgtggacttcctgcacatccac
cgcatcgtccaccgggacctcaagccccagaacctgctagtctccgctcagggccacctc
aagatcgccgacttcggtctggccaagacctacgacgcggagatgaagctcacctcggtg
gtggtcacgttgtggtaccgtgctcccgaagttctcctctgccagtcctacagcagcgca
gtggacatctggagctgtgcctgcatcatcttcgaaatgttcaatcgccgggccatgttt
ccgggcaactccgagaagaatcaactggatcgcattttcgaacttacaggtcgcccctcg
gaaaaggactggcctgccaccatctcagtgtcgagggaacagtttccccaaagactgccc
aagagacccaaggatttctgtcccagtttatgcgagttctccgatgatttgttacataaa
atgctctcctatgacatgcgagtgcgtccgccggccctgacctgcctgcagcacgagttc
ttcaaacaggagtacctttag

DBGET integrated database retrieval system