KEGG   Drosophila ananassae: Dana_GF11462Help
Entry
Dana_GF11462      CDS       T01059                                 

Definition
GF11462 gene product from transcript GF11462-RA
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
dan  Drosophila ananassae
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dana_GF11462
   00330 Arginine and proline metabolism
    Dana_GF11462
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Dana_GF11462
Enzymes [BR:dan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Dana_GF11462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 725 aa AA seqDB search
MLKGVPTLAGRNLRFLTGHGQVLACSQRLKASTAELAEDPALVDLDQEPNLLKRAKFGHT
GKQLQQKIASENKLRAPPLLNLVFANRKLSFYDTSSGPKSHNDENAKLNQRRHYSMRPHR
EQEQRNAEDVLFDMFASEETGLISMGKFLAGLKTTGIRRNDPRVRELMDNLKKVHKLNNY
ETGSSAETQHLNRETFKAVVAPNIVLIAKAFRQQFVIPDFSSFVKDIEEIYCRCKSNTLG
KLADYIPQLARYSPDFWGVSICTVDGQRYSIGDVEEPFTLQSCSKPLTYAIALEKLGPKV
VHSYVGQEPSGRNFNELVLDQNKKPHNPMINAGAILTCSLMNALVKPDMTSAEIFDYTMS
WFKRLSGGEYIGFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDYYFQCCSM
ETNCEAMSVIAASLANGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFKVGLPA
KSGVSGGMMLVIPNVMGIFAWSPPLDHLGNTVRGLQFCEELVNMFNFHRYDNLKHLSSKK
DPRKHRYETKGLSIVNLLFSAASGDVTALRRHRLSGMDITLADYDGRTALHLAASEGHLE
CVKFLLEQCHVPHNPKDRWGNLPVDEAENFGHRHVVEFLCSWAEKADVASEECKPEAVTT
KTQADEEIVSTSDLETSPATSPIPTPAEPGTPAGSGRSSPVPSDAGSTASVGSGSSREDK
TKPGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaggtgttcccacgctagccggtcgtaacctgcgcttcttgacgggacacgga
caggtgttggcctgttcccaacgcttgaaggcctccaccgccgagttggccgaggatccg
gcattggtggatttggaccaggaacctaatctcttgaagcgcgccaagttcggacacacg
ggcaaacagctgcagcagaaaattgccagcgagaataaactgcgcgctcccccgctattg
aatttggtattcgccaatcgcaagttatccttctatgataccagctctggacccaagagc
cacaatgacgagaatgccaaactcaatcagcgacgccactattcgatgcggcctcatcgc
gagcaggagcaacggaatgctgaggacgttcttttcgatatgttcgccagcgaggagacg
ggcctcatatcgatgggaaagttcctggccgggctgaagaccactggcattcgcaggaat
gatcctcgagtgcgcgagttgatggataatctaaagaaagttcataaactgaacaactac
gagacgggttcctctgcggaaacccagcatctgaaccgggagactttcaaggctgtggtg
gctcctaatattgtcctcatagccaaggccttccggcaacagtttgtcattcccgacttc
tcgagtttcgttaaggacatcgaggagatctactgtcgctgcaagagcaataccttggga
aaactggccgactatattcctcagttggcccgatacagtcctgatttctggggcgttagc
atttgtacagtggatggccagcggtactccatcggtgatgtggaggagcccttcaccctc
cagagttgcagcaaaccactgacctatgccatcgctttagagaaactgggacccaaggtg
gtgcactcttacgttggccaggagccaagtggaaggaactttaatgaactggtcctggat
caaaacaagaaaccccacaacccgatgatcaatgctggtgccatacttacttgctctctg
atgaatgctctggtcaagccagacatgacctcggcagagatcttcgactataccatgtcc
tggttcaagcgtctctccggcggcgagtacattggcttcaataatgccgtattcctgtcg
gaacgcgaggctgccgatagaaactatgccctaggcttctacatgcgggagaacaagtgc
ttccccaagcgcaccaacctaaaagaggtgatggactactacttccagtgctgctccatg
gagaccaactgcgaggccatgtcggtgattgccgccagcttggccaacggtggcatctgc
ccaaccaccgaggagaaggtcttccggccggaagtcatacgggatgtactctccatcatg
cactcctgcggcacctacgactactccggtcagttcgccttcaaggtgggtctgccggcc
aagtctggtgtcagcggcggcatgatgctggtcattcccaacgttatgggcatcttcgcc
tggtcaccgcccctggatcatctgggcaacacagtgcgaggactgcagttctgcgaggaa
ctggtcaacatgttcaacttccatcgctacgataacctgaagcacctgtccagcaagaag
gatccccgcaagcatcgctacgagaccaaaggcctgtccattgtgaaccttctgttctcg
gctgccagcggagatgtcaccgccttgaggcgccatcgcctctccggaatggacatcacc
ctggccgattatgatggccgcacagccctccatctggccgcctccgaggggcatctggag
tgcgtcaagttcctgctggagcagtgccatgtgccgcacaatcccaaggatcgttggggc
aacctgccagtggacgaggccgagaacttcggccaccgtcacgtggtggagttcctgtgc
tcttgggccgagaaggcggacgtcgccagcgaggagtgcaagcccgaggcggtcaccacc
aagacgcaagcagatgaggaaattgtcagcaccagcgatctggagaccagcccggccacc
agtcccattcctacgcccgccgaaccgggaacgccggccggatccggccgctccagtccg
gtgccatcggatgcgggtagtacggccagcgtcggcagtggaagcagcagagaggacaag
accaagccaggactataa

  All links  
No link information was found.   
DBGET integrated database retrieval system