KEGG   Drosophila ananassae: Dana_GF11475Help
Entry
Dana_GF11475      CDS       T01059                                 

Definition
(RefSeq) GF11475 gene product from transcript GF11475-RC
  KO
K10374  
tropomyosin 2
Organism
dan  Drosophila ananassae
Brite
Cytoskeleton proteins [BR:dan04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     Dana_GF11475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEVDLVTA
KEQLEKANTELEEKEKLLTSTESEVATLNRKVQQIEEDLEKSEERSTTAQQKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSAKLKEAEQRAE
HAEKQVKRLQKEVDRLEDELGINKDRYKSLADEMDSTFAELAGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcaagcgatgaagcttgagaaggataatgccattgat
aaggccgatacctgcgagaaccaagctaaggatgccaactcccgcgccgacaaactgaac
gaggaggtgcgcgatctggagaagaagttcgtccaggttgaggttgatctggtcaccgcc
aaggagcagctggagaaggctaacaccgagctggaggagaaggagaaactccttacctcc
accgaatcggaggtggccaccctcaaccgtaaggttcaacagattgaggaggatctggag
aagtccgaggagcgctcgaccaccgcccaacagaagctgctggaggccacccagtcggct
gatgagaacaaccgtatgtgcaaggtgttggagaaccgttcccagcaggatgaggagcgc
atggatcagctcaccaaccagctgaaggaggcccgcatgctcgctgaggatgctgatacc
aagtccgatgaagtctcccgcaagctggccttcgttgaagacgagctggaggttgctgag
gatcgtgtccgttccggcgagtccaagatcatggagctggaggaggagctgaaggttgtc
ggcaactctctgaagtctctggaggtgtctgaggagaaggccaaccagcgcgtggaggag
ttcaagcgcgagatgaagaccctgtccgccaagttgaaggaggccgagcagcgtgccgag
cacgccgagaagcaggtcaagcgcctgcagaaggaggtcgacaggctagaggacgagctg
ggcatcaacaaggacaggtacaagtccctggccgacgagatggactccacattcgccgaa
ttggctggctattaa

DBGET integrated database retrieval system