KEGG   Drosophila ananassae: Dana_GF11475Help
Entry
Dana_GF11475      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform C
  KO
K10374  tropomyosin 2
Organism
dan  Drosophila ananassae
Brite
Cytoskeleton proteins [BR:dan04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     Dana_GF11475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 DUF745 ATG16 MscS_porin Laminin_II ERM EzrA Spc7 CLZ DUF1664 DUF4200 Reo_sigmaC Cep57_CLD_2 IncA Uds1 BST2 AAA_13 BicD FPP APG6 DUF724 TTKRSYEDQ Alanine_zipper BLOC1_2 XhlA BCL_N TPR_MLP1_2 WEMBL Fez1 ORF6C DUF3450 Golgin_A5 CENP-F_leu_zip LPP Lebercilin DUF4472 HOOK SlyX FUSC Fib_alpha Polysacc_deac_2 FlaC_arch Laminin_I T3SSipB IFT57 DUF3584 TMPIT HemX
Motif
Other DBs
NCBI-GeneID: 6494339
NCBI-ProteinID: XP_001965935
FlyBase: FBgn0088515
UniProt: B3MX79
Position
Unknown
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEVDLVTA
KEQLEKANTELEEKEKLLTSTESEVATLNRKVQQIEEDLEKSEERSTTAQQKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSAKLKEAEQRAE
HAEKQVKRLQKEVDRLEDELGINKDRYKSLADEMDSTFAELAGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcaagcgatgaagcttgagaaggataatgccattgat
aaggccgatacctgcgagaaccaagctaaggatgccaactcccgcgccgacaaactgaac
gaggaggtgcgcgatctggagaagaagttcgtccaggttgaggttgatctggtcaccgcc
aaggagcagctggagaaggctaacaccgagctggaggagaaggagaaactccttacctcc
accgaatcggaggtggccaccctcaaccgtaaggttcaacagattgaggaggatctggag
aagtccgaggagcgctcgaccaccgcccaacagaagctgctggaggccacccagtcggct
gatgagaacaaccgtatgtgcaaggtgttggagaaccgttcccagcaggatgaggagcgc
atggatcagctcaccaaccagctgaaggaggcccgcatgctcgctgaggatgctgatacc
aagtccgatgaagtctcccgcaagctggccttcgttgaagacgagctggaggttgctgag
gatcgtgtccgttccggcgagtccaagatcatggagctggaggaggagctgaaggttgtc
ggcaactctctgaagtctctggaggtgtctgaggagaaggccaaccagcgcgtggaggag
ttcaagcgcgagatgaagaccctgtccgccaagttgaaggaggccgagcagcgtgccgag
cacgccgagaagcaggtcaagcgcctgcagaaggaggtcgacaggctagaggacgagctg
ggcatcaacaaggacaggtacaagtccctggccgacgagatggactccacattcgccgaa
ttggctggctattaa

DBGET integrated database retrieval system