KEGG   Drosophila ananassae: Dana_GF11475Help
Entry
Dana_GF11475      CDS       T01059                                 

Definition
GF11475 gene product from transcript GF11475-RA
Organism
dan  Drosophila ananassae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEVDLVTA
KEQLEKANTELEEKEKLLTSTESEVATLNRKVQQIEEDLEKSEERSTTAQQKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSAKLKEAEQRAE
HAEKQVKRLQKEVDRLEDRLFHEKEKYKAICDDLDQTFAELTGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcaagcgatgaagcttgagaaggataatgccattgat
aaggccgatacctgcgagaaccaagctaaggatgccaactcccgcgccgacaaactgaac
gaggaggtgcgcgatctggagaagaagttcgtccaggttgaggttgatctggtcaccgcc
aaggagcagctggagaaggctaacaccgagctggaggagaaggagaaactccttacctcc
accgaatcggaggtggccaccctcaaccgtaaggttcaacagattgaggaggatctggag
aagtccgaggagcgctcgaccaccgcccaacagaagctgctggaggccacccagtcggct
gatgagaacaaccgtatgtgcaaggtgttggagaaccgttcccagcaggatgaggagcgc
atggatcagctcaccaaccagctgaaggaggcccgcatgctcgctgaggatgctgatacc
aagtccgatgaagtctcccgcaagctggccttcgttgaagacgagctggaggttgctgag
gatcgtgtccgttccggcgagtccaagatcatggagctggaggaggagctgaaggttgtc
ggcaactctctgaagtctctggaggtgtctgaggagaaggccaaccagcgcgtggaggag
ttcaagcgcgagatgaagaccctgtccgccaagttgaaggaggccgagcagcgtgccgag
cacgccgagaagcaggtcaagcgcctgcagaaggaggtcgacaggctagaggaccgtctc
ttccatgagaaggaaaaatacaaagcaatctgcgacgatttggaccagacatttgccgaa
cttactggatattaa

DBGET integrated database retrieval system