KEGG   Drosophila ananassae: Dana_GF11546Help
Entry
Dana_GF11546      CDS       T01059                                 

Definition
GF11546 gene product from transcript GF11546-RA
Orthology
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
dan  Drosophila ananassae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dana_GF11546
Enzymes [BR:dan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dana_GF11546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 841 aa AA seqDB search
MHWALYNSCTVVHKHLPALDLQHNIGDYMQQVPPAGEIERPPIQIGETYYAVKNKAIASW
VSIKVIEFTESTAIGGNTMKSYKIKYLNTPYQMVKTVTAKHIAYFEPPPVRLTIGTRVIA
YFDGSTLSRGKDKGVVQSAFYPGIIAEPLKQANRFRYLIFYDDGYTQYVQHRDVRLVCQA
SEKVWEDVHPASRDFIQKYVEKYSVDRPMVQCTRGQSMNTESNGTWLYARVIDIDCSLVL
MHFEADKNHTEWIYRGSLRLGPVFKETQNAMSSANAHHARVPRRTEPFIRYTKEMESSNM
QVNQQMRAMARKSSSVAQGAVTSAASSSSANTSAAGRSGGGNASRGPVKHLNNSTIYVDD
ENRPKGHVVYFTAKRNLPPKVYRHHECNPNCLFKIVHRLDSYSPLAKPLLSGWERLVLRQ
KTKKNVVYRGPCGKSLRNLAEVHTYLRATENVLNVDNFDFTPDLRCLAEYSIDPTIVKEA
DISKGQEKMAIPLVNYYDNSLPPPCTYAKQRIPTEGVHLNLDEEFLVGCDCDDDCSDKSK
CSCWQLTVAGVKYCNPKKPIEEIGYQYKRLHEHVPTGIYECNSRCKCKKNCLNRVVQHSL
EMKLQVFKTSNRGWGLRCVNDIPKGAFICIYAGHLLTETMANEGGQDAGDEYFADLDYIE
VAEQLKEGYESEVEQSEPEPEEDSYLPEAEDDDDFRPNNYYQKKNKLRPTRSNSASAQST
EVDSQERAVINFNPNADLDETVRENSVRRLFGKDEAPYIMDAKTTGNLGRYFNHSCNPNL
FVQNVFVDTHDLRFPWVAFFSASHIRSGTELTWNYNYEVGVVPGKVLYCQCGAPNCRIRL
L
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgcactgggccctttacaattcctgcacggtggtgcacaagcacttgccggccctggat
cttcaacacaacataggcgactatatgcagcaagtccctccagcaggggaaatcgagcga
ccgcctatccagattggggagacttactacgccgttaagaataaggctatagccagctgg
gtgtccataaaggtgatcgagttcacggagagcacggccatcggtgggaacacgatgaag
agctacaagatcaagtatctgaataccccataccagatggtaaagacagtgacggccaag
cacatagcttactttgagccgccgccagtgcgccttacaattggcacccgagtgatcgct
tactttgacggctctactctgagccgaggaaaggacaaaggcgttgtgcaaagcgcgttc
tatccgggaattattgccgagccgctgaagcaggcaaatcggttcagataccttatattc
tacgatgatggatacacgcagtatgtgcagcatcgggatgttcgtctggtgtgccaggcc
tcggaaaaggtttgggaggatgtgcaccccgcgtctcgcgactttatccagaagtacgtg
gaaaagtattcggttgacaggcccatggtgcagtgtacccgcggccagagcatgaacacc
gagtcgaacggcacctggctttacgcgcgcgtcattgacattgactgtagcctggtcctg
atgcactttgaggcggacaaaaaccacaccgagtggatttacagaggctccttgagactc
ggtccggtatttaaggaaactcagaatgccatgagcagtgccaacgcgcaccacgcgcga
gtaccaaggcgcacagaacctttcattcgctacaccaaggagatggagtcgagcaacatg
caggtgaaccaacaaatgcgggccatggcccgcaaaagcagctccgtcgcgcaaggcgca
gttacctcagcagcgtcatcatcttcggccaatacttcggctgccggccgcagtggcgga
ggaaatgctagccgcgggcccgtcaagcatttaaacaattcgaccatatacgtcgacgac
gagaaccgccccaagggccatgttgtttattttacggccaaacgcaacctgccgcctaag
gtgtatcgccaccacgagtgcaacccgaactgtttgttcaagatcgtccaccgtctcgac
agttacagcccacttgctaaacccctgctgtccggctgggagcgcctggtgctgcgccaa
aagactaaaaagaacgttgtgtacaggggaccctgcggcaaaagtctgcgcaacttggcg
gaggtacacacctaccttcgagccaccgaaaatgtcctgaatgtggataactttgacttc
acgccggatttgaggtgtttggctgaatactcaatcgatcccacgattgtcaaagaggcg
gacatatctaagggccaggagaaaatggccatcccgttggtcaactactacgacaactcc
ctgcctcctccatgtacctacgccaagcagagaatccccaccgagggagtgcacttgaat
cttgatgaggaattccttgtcggttgcgattgcgatgacgactgctcggacaagtccaag
tgctcctgctggcaactgactgtggctggtgtcaagtactgcaaccccaaaaagcccatc
gaagagatcggataccagtataagcggttgcacgagcatgtgcccactggcatttatgag
tgcaactcacgctgtaaatgcaaaaagaactgcctcaaccgagtagtgcaacactcgctg
gagatgaaattgcaggtttttaagacctctaatcgaggctgggggctgcgatgcgttaac
gacatccccaaaggcgcctttatatgcatctacgctggccacctgctcacagaaacgatg
gccaatgagggtggccaagatgctggtgacgaatacttcgccgatttggactacatcgaa
gtggccgaacaactaaaagagggctacgagtcggaggttgagcaatccgagcctgaacca
gaggaagattcttatctgccggaagccgaagacgacgatgatttccgaccaaacaactac
tatcagaagaagaacaagttgcgccccacacgcagtaatagcgcctcagcccaatccaca
gaagtagactcgcaggagcgagcggttatcaacttcaacccgaacgctgatctggacgag
acagtgcgagagaactctgtacggcggctgtttggcaaggatgaggcgccatacattatg
gatgctaaaacaaccggaaacctggggcgctactttaaccactcgtgcaaccctaatctt
ttcgttcaaaacgtcttcgttgacacccacgacctgcgttttccttgggtggcatttttt
tcggcctcccacatacgctccggcacagaactgacctggaactacaactacgaagtgggc
gtggtgcccggcaaggtgttatactgccagtgtggagcccctaactgccgcatacgcttg
ctttaa

DBGET integrated database retrieval system