KEGG   Drosophila ananassae: Dana_GF11632Help
Entry
Dana_GF11632      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K14298  mRNA export factor
Organism
dan  Drosophila ananassae
Pathway
dan03013  RNA transport
Module
dan_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dana_GF11632
Messenger RNA biogenesis [BR:dan03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dana_GF11632
Chromosome and associated proteins [BR:dan03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Dana_GF11632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 eIF2A
Motif
Other DBs
NCBI-GeneID: 6494496
NCBI-ProteinID: XP_001960222
FlyBase: FBgn0088672
UniProt: B3MIX8
Position
Unknown
AA seq 346 aa AA seqDB search
MFSATQSTNRMNDFEVASPPDDSISALEFSPNTLQKNFLIAGSWDNSVRCWEVEQNGATV
PKSMKTMGGPVLDVCWSDDGTKVFVASCDKQVKLWDLASDQVMQVAAHDGPVRTCHMVKA
PTYTCLMTGSWDKTLKFWDMRSPNPMMTINLPERCYCADVDYPMAVVGTANRGLIIYSLQ
NSPTEYKRQESPLKYQHRAISIFKDKKKEPTGYALGSIEGRVAIQYVSPANPKDNFTFKC
HRSTGTAGFQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSEAMDQSITKC
GFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtttagtgctacacaatctaccaaccggatgaatgacttcgaggtggcctcgccaccc
gacgactccatatcggcgctcgagttcagcccgaacacgctgcagaagaactttctgatt
gccggcagctgggacaacagtgtccgctgctgggaggtggaacaaaatggagcaaccgtg
ccgaagtcgatgaagaccatgggcggcccagtgctggacgtgtgctggtcggacgacggc
accaaagtatttgtggcctcctgcgacaagcaagtaaagctctgggacctggcctccgac
caggtgatgcaagtggcggcacatgacggccctgtgcggacgtgccacatggttaaggca
cccacatacacctgtctgatgactggctcttgggacaagacgctaaagttctgggacatg
cgttcccccaaccctatgatgactatcaacctacccgaacgttgctactgtgccgacgtc
gactacccaatggctgtagttggcaccgccaaccgaggcttgatcatatattcgttgcaa
aacagtcccacggaatataaacgccaggaaagtccgctcaagtaccagcaccgcgccata
tcaatttttaaagataagaagaaggagcccacgggctatgccctaggcagtatcgaaggc
cgtgttgccattcagtatgtgagccccgcaaatcccaaggataacttcacattcaagtgc
caccgctccacgggcacggcaggcttccaggacatttacgccgtgaacgacatagcattc
catccggtgcatggcactctggtaaccgtcggatctgatggaacattcagtttctgggat
aaggatgcccgcaccaagctgaagtcgagcgaggctatggaccaatctattaccaaatgc
ggattcaatgccaatggccagatcttcgcctacgccgtgggctacgactggtccaagggg
catgagtactttaatcctgctaagaagccccaaatcttcctgcgctcgtgctatgacgag
cttaaaccacgtatcaactga

DBGET integrated database retrieval system