KEGG   Drosophila ananassae: Dana_GF11632Help
Entry
Dana_GF11632      CDS       T01059                                 

Definition
(RefSeq) GF11632 gene product from transcript GF11632-RA
  KO
K14298  
mRNA export factor
Organism
dan  Drosophila ananassae
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dana_GF11632
Messenger RNA biogenesis [BR:dan03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dana_GF11632
Chromosome [BR:dan03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Dana_GF11632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 346 aa AA seqDB search
MFSATQSTNRMNDFEVASPPDDSISALEFSPNTLQKNFLIAGSWDNSVRCWEVEQNGATV
PKSMKTMGGPVLDVCWSDDGTKVFVASCDKQVKLWDLASDQVMQVAAHDGPVRTCHMVKA
PTYTCLMTGSWDKTLKFWDMRSPNPMMTINLPERCYCADVDYPMAVVGTANRGLIIYSLQ
NSPTEYKRQESPLKYQHRAISIFKDKKKEPTGYALGSIEGRVAIQYVSPANPKDNFTFKC
HRSTGTAGFQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSEAMDQSITKC
GFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtttagtgctacacaatctaccaaccggatgaatgacttcgaggtggcctcgccaccc
gacgactccatatcggcgctcgagttcagcccgaacacgctgcagaagaactttctgatt
gccggcagctgggacaacagtgtccgctgctgggaggtggaacaaaatggagcaaccgtg
ccgaagtcgatgaagaccatgggcggcccagtgctggacgtgtgctggtcggacgacggc
accaaagtatttgtggcctcctgcgacaagcaagtaaagctctgggacctggcctccgac
caggtgatgcaagtggcggcacatgacggccctgtgcggacgtgccacatggttaaggca
cccacatacacctgtctgatgactggctcttgggacaagacgctaaagttctgggacatg
cgttcccccaaccctatgatgactatcaacctacccgaacgttgctactgtgccgacgtc
gactacccaatggctgtagttggcaccgccaaccgaggcttgatcatatattcgttgcaa
aacagtcccacggaatataaacgccaggaaagtccgctcaagtaccagcaccgcgccata
tcaatttttaaagataagaagaaggagcccacgggctatgccctaggcagtatcgaaggc
cgtgttgccattcagtatgtgagccccgcaaatcccaaggataacttcacattcaagtgc
caccgctccacgggcacggcaggcttccaggacatttacgccgtgaacgacatagcattc
catccggtgcatggcactctggtaaccgtcggatctgatggaacattcagtttctgggat
aaggatgcccgcaccaagctgaagtcgagcgaggctatggaccaatctattaccaaatgc
ggattcaatgccaatggccagatcttcgcctacgccgtgggctacgactggtccaagggg
catgagtactttaatcctgctaagaagccccaaatcttcctgcgctcgtgctatgacgag
cttaaaccacgtatcaactga

DBGET integrated database retrieval system