KEGG   Drosophila ananassae: Dana_GF11909Help
Entry
Dana_GF11909      CDS       T01059                                 

Gene name
Dana_ST6Gal
Definition
Sialyltransferase
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
dan  Drosophila ananassae
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:dan00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:dan00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 444 aa AA seqDB search
MRQVKRALPGQCQALLVSLIVCAALIIQSEQQVGDAKAQRRHEPIEVNTPEAANVRSPRS
VFHVRWNPNEKFIVESRENPAINSSKLAPHPRLKVSKNTKLTLSPKLYLCHDKHSELCHN
KTQQFRQRIVQTFEKAMTESVNESDPNHYNVDYKPVFGDSFEEQYYPSTCLVMEAGVRVL
RRKDEPFNKLPFGRLFPRQKLFRNIRNIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNH
APTEGHEVDVGSKTTIRVVNSQVVTKPEFDFTRAPIFRNVTIAAWDPGKYNGTLEDWLTS
ADYDLFTNYEIYRRRYPKSRAFLIDPHSVWRLWQSLQMFAGNRAIRRNPPSSGFIGLALL
LPHCPQVDFVEYVPSTRLNGRCHYYSKEMNSACTFGSWHPLAAEKLMALDMNMAEDDDMS
VFQFGILRIRRPDKLLCGFNFFGY
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaagtgaaacgcgcattgccaggtcagtgtcaggccctactcgtcagcctcatt
gtgtgcgccgcgttaataattcaaagcgagcagcaagtcggcgacgcgaaagctcagcgg
agacacgaacccatcgaggtgaataccccggaagcggccaacgttcgtagtcctcggagt
gttttccacgtgcgctggaatccgaatgagaaattcatcgtcgaaagccgcgaaaatccg
gctattaattcctccaaactggccccacatcctcgcctgaaggtctccaagaacaccaag
ctaacgctcagtcccaagttatatctctgccatgacaagcactcggagctgtgccacaac
aagacccagcagttccgacagcggattgtccagacctttgagaaggccatgactgagtcg
gtcaacgagtcggatccgaatcactataatgtggactacaaaccagttttcggcgacagt
ttcgaggagcagtactatccctctacttgcctggtgatggaggcgggtgttagagtcctt
cgacgcaaggatgagcctttcaacaagttgcctttcggcagactttttccccgccagaaa
ctttttcgcaatattcggaatatcaagacctgtgccattgtttccagtgccggttctctg
gcaggctctaaactaggtcgatttatagacacgcacgacattgtgatgagattcaaccat
gccccaacggaaggacacgaggtggatgttggcagcaaaaccacaattcgtgtggtgaat
tcgcaagtggtgacaaagcccgagtttgatttcacacgcgctcccatctttcgcaatgtc
acgatcgccgcctgggatcctggcaagtacaatggcactctggaggactggctcaccagt
gcggactacgatctctttaccaattacgaaatatatagacgacgctatcccaaatcgagg
gccttcttgattgatccacattccgtgtggcggttgtggcagagtttgcaaatgtttgcc
ggcaatcgggctatcagaaggaatcctccaagttcagggtttatcggactggctctactc
ctgccacattgtccgcaggtggactttgtggagtatgttccctccacgcggctcaatgga
cgctgtcactactacagcaaagagatgaattccgcctgcacattcggctcctggcatcca
ctggccgccgagaagctgatggctctggacatgaatatggcggaggatgatgatatgtcg
gttttccaatttggtattctccgtatacgccggccagataaattgctctgcggcttcaat
ttctttggctactga

DBGET integrated database retrieval system